KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4417
Entry
G2583_4417        CDS       T01190                                 

Name
(GenBank) hypothetical protein
  KO
K12787  LEE-encoded effector Map
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4417
SSDB
Motif
Pfam: IpaB_EvcA
Other DBs
NCBI-ProteinID: ADD58884
UniProt: D3QW23
LinkDB
Structure
PDB: 
3GCG

Position
complement(4489534..4490145)
AA seq 203 aa
MFSPMTMAGRSLVQATAQTLKPAVTRAAMQAGTGATGMRFMPVQSNFVINHGKLTNQLLQ
AVAKQTRNGDTQQWFQQEQTTYISRTVNRTLDDYCRSNNSVISKETKGHIFRAVENALQQ
PLDMNGAQSSIGHFLQSNKYFNQKVDEQCGKRVDPITRFNTQTKMIEQVSQEIFERNFSG
FKVSEIKAITQNAILEHVQDTRL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtttagtccaatgacaatggcaggcagatcgttagttcaggcgactgcacagacgctt
aaacctgcggttaccagagctgcaatgcaagcgggtacgggagccacgggtatgaggttc
atgcccgtgcagtcgaactttgtgattaatcatggcaaactgactaaccaactcctgcag
gctgtagccaaacaaactcgtaatggcgatacccaacaatggttccagcaggagcagacg
acttatatatccagaacagtaaatagaactctggatgactattgcaggagtaataattcg
gtcattagtaaggagactaaaggtcacatttttagagctgttgaaaatgcgttacagcaa
cctcttgatatgaacggggcacaatcatcaattggtcacttcttgcagtccaataaatac
tttaatcagaaagttgatgagcagtgcggcaaaagagtggatccaataacacgttttaac
acccagacgaagatgatagaacaagtctcacaagaaatatttgaacgcaactttagcggc
ttcaaagtcagtgagataaaagcgattactcagaatgcgattttagagcatgtacaggat
acccgattgtag

DBGET integrated database retrieval system