KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_4427
Entry
G2583_4427        CDS       T01190                                 
Name
(GenBank) hypothetical protein
  KO
K23661  type III secretion system protein
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eok00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    G2583_4427
SSDB
Motif
Pfam: T3SS_basalb_I
Other DBs
NCBI-ProteinID: ADD58894
UniProt: D3QW33
LinkDB
Position
4497416..4497844
AA seq 142 aa
MDVLCPCLFHKKRLTVNMNNINQSENINIQLNKAPQTNFVDEHTSLASAPSAAGAAQFLD
QLLPKTAGVSSPEQVLIEEIKKRHLATMNSDLSFDALSAGGLSPEDVLTLQKNVLNANVN
VDVVSKLASLLSTSVTKLVSMQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atggatgtattatgcccttgcctctttcataaaaagaggctaacagtaaatatgaacaac
attaatcaatcggaaaacattaatattcaattaaataaagcgccccaaacaaatttcgtt
gatgagcatacctcgttagcctcagccccctctgcggcaggtgcggctcagtttcttgat
caattactccctaaaacagcgggagtgtcttctccagaacaagtgttgattgaagaaatt
aaaaagagacatcttgcaacaatgaacagcgatctcagtttcgatgctctatctgcaggt
gggctctcgccagaagacgtgctcaccttacaaaagaatgtgctcaacgcaaacgtcaac
gttgatgtcgtatctaagttagcaagcctcctttcaacatcggttacaaaattagtttcg
atgcaataa

DBGET integrated database retrieval system