KEGG   Equus przewalskii (Przewalski's horse): 103542616
Entry
103542616         CDS       T04644                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04927  Cortisol synthesis and secretion
epz04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:epz00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    103542616 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103542616 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 FixQ
Other DBs
NCBI-GeneID: 103542616
NCBI-ProteinID: XP_008507773
LinkDB
Position
Un
AA seq 158 aa
MANQTNTSAPFYSYEYYLDYLDLIPVDERKLKANKHSIVIVFWVSLAAFVVLLFLILLYM
SWSGSPQMRDNTQHHPTCPWSHSLNLPFCVRRHPPHHRDPRGTRQAPPSSAEEPGSRASG
RDQQPQGESPSALSPTAPQAHCALLWELTPDGDPHRVS
NT seq 477 nt   +upstreamnt  +downstreamnt
atggccaaccagaccaacacctccgccccattctacagctacgaatattacctggactac
ctggacctcattcccgtggatgagaggaagctgaaagccaacaagcattccatcgtcatc
gtcttctgggtgagcctggcggccttcgtggtgcttctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgagggacaacacccagcaccacccaacatgtccctgg
agtcacagcctcaacctccccttctgtgtccggaggcacccaccacaccacagggaccct
cgggggacccggcaagctccaccgagctcggctgaggaaccaggcagcagagcatccggc
cgcgatcagcagccgcagggagagagcccctctgccttgtcccccacagccccccaggcc
cactgtgccctcctctgggaactgacccctgatggggacccccaccgcgtcagctga

DBGET integrated database retrieval system