KEGG   Equus przewalskii (Przewalski's horse): 103552190
Entry
103552190         CDS       T04644                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:epz00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103552190 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:epz04050]
    103552190 (TNFRSF8)
   04090 CD molecules [BR:epz04090]
    103552190 (TNFRSF8)
Cytokine receptors [BR:epz04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103552190 (TNFRSF8)
CD molecules [BR:epz04090]
 Proteins
  103552190 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 103552190
NCBI-ProteinID: XP_008520260
LinkDB
Position
Un
AA seq 616 aa
MWLVHNASPQAHCGPTPQPLCPQNSSDCPKQCEPDYYLSAHGRCTACVSCAGDDLVEKKP
CSWNSPRVCECRAGMFCATSATNSCARCFPHSDCPPGMIVKFQGTAEKDTICEPPSPRAS
PDCSTSPEDCEAPASDSTLQAKPALTSPARSDARTMLLGGGTPEEDSKMTRAPNSPSSVG
KPSPDLGPTPQQPCPQGSADCRKQCEPDYYLERDGRCTACVSCAGDDLVEKTPCTWNSSR
VCECRPGMFCATSATNSCARCVARPICPPGMVTKLQGAAERDTTDNPPPPGSHPNCSTNP
EDREASASPCPQGRDWPEDLGTQALSTPSLRKEMTPEHTLPLFLLVISLTSGFSPGSSTP
SLADPQTSMGPGGGITHAWGDASILTSAPISFSSTGKPMLVSGPVLFWVIMTLVVVVGSS
SFLLCHRRACRKWIRQSEWMCYPVRTFRPKLEPGLVDSRPRRKSPLRRSVSLAEPGMAEL
GLMSSPSPAVETCPSVGAAGQETLRLLEASPASRPSSPTGPPEPRVTTEHTNNRIEKIYI
MKADTVIVGTVKTEVPEGRGLVGPAGPEFEEDLEVDHAPHYPEQETEPPLGSCGDVMFSV
EEEGKEDPLPTTASGK
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgtggctggtgcacaatgcttctccccaggcccactgcgggccgaccccgcagccgctg
tgcccgcagaattcatctgactgcccgaagcagtgtgagcccgattactacctgagcgcc
catggccgctgcacggcctgtgtgagctgcgcgggagatgacctcgtggagaagaagccg
tgttcatggaactccccccgtgtctgcgagtgccgggctggcatgttctgtgccacgtca
gccaccaactcctgtgcccgctgcttcccccactccgactgcccaccagggatgattgtc
aagttccagggcacagcggagaaggacaccatctgtgagccaccttccccgagggctagc
cctgactgcagcaccagcccagaggactgcgaggcacccgccagcgacagcaccctgcag
gccaagcccgccctgacctccccagcacgttccgatgccaggaccatgctgcttggaggg
ggcaccccggaagaagattccaagatgacgagggctcccaactccccctcctccgtgggg
aagcccagtccagatctagggccgaccccacagcagccgtgccctcaggggtccgccgac
tgcaggaagcagtgtgagcccgactactacctggagagggacggccgctgcacggcctgt
gtgagctgcgcaggagatgatctcgtggagaagacaccttgcacttggaactcctcccgt
gtgtgtgagtgtcgacctggcatgttctgtgccacatcagccaccaactcctgtgcccgc
tgcgttgcccgccccatctgcccaccagggatggtcaccaaactccagggtgcggctgag
agggacaccacggacaacccgcctcccccgggatcccaccctaactgcagcaccaaccca
gaggacagagaggcgtctgccagcccctgccctcaaggcagagactggccggaggacctg
gggactcaggccctgtctacaccgtctcttaggaaggaaatgactcctgagcacacactt
cccctcttccttctcgtcatcagtcttacctctggcttctctcccggcagctccacccct
tccctggcagacccccagaccagcatggggcctggagggggcattacccacgcctggggg
gacgcctccatcctgacgagtgctcccatctctttctcctccaccggaaagcccatgctg
gtttcaggacctgtgctcttctgggtgatcatgacgctggtggtggtcgtcggctccagc
tccttcctcctgtgccaccggagggcctgcaggaagtggattcggcagagtgagtggatg
tgctacccggtccggaccttccggcccaagctggagcctgggttagtggattccaggccc
agaaggaaatcaccgctgaggaggagcgtgtcgctggcagaaccaggcatggctgagctg
gggctaatgagctccccctccccggctgtggagacctgccccagtgtgggggccgccggc
caggagaccctgaggctgctggaggccagtcccgccagcaggccctcgtcccccacgggc
cctcccgagccccgggtgaccacggagcatactaataacaggatcgagaaaatctacatc
atgaaggccgacacagtgattgtggggaccgtgaagaccgaggtgcctgagggccggggc
ctggtggggccagcggggcccgagttcgaggaggatctggaagtggaccatgctccccac
taccccgagcaggagaccgaaccacccctgggcagctgcggggacgtcatgttctcggtg
gaggaggaagggaaggaggaccccttgcccacaaccgcctctgggaaatga

DBGET integrated database retrieval system