KEGG   Equus przewalskii (Przewalski's horse): 103557317
Entry
103557317         CDS       T04644                                 
Symbol
RIMKLA
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
epz  Equus przewalskii (Przewalski's horse)
Pathway
epz00250  Alanine, aspartate and glutamate metabolism
epz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103557317 (RIMKLA)
Enzymes [BR:epz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     103557317 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     103557317 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C TTL Rimk_N
Other DBs
NCBI-GeneID: 103557317
NCBI-ProteinID: XP_008527966
LinkDB
Position
Un
AA seq 365 aa
RQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQKALTTFPDVVLVRVPTPSVQSDSDIT
VLRHLEKLGCRLVNRPQSILNCINKFWTFQELAGHGVPMPDTFSYGGHEDFSKMIDEAEP
LGYPVVVKSTRGHQGKAVFLARDKHHISDICHLIRHDVPYLFQKYVKESHGKDIRVVVVG
GQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDD
GSFVVCEANANVGFLAFDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPREKKEP
DGCASAQGVAENVYTINSGSTSSESEPELAEIRDSSASTTGAPPPMLPEPGYNINNRIAS
ELKLK
NT seq 1098 nt   +upstreamnt  +downstreamnt
cggcagcgctgctccgagcaggacgtgcgcttccgggcggtgctcatggaccagatcgcc
gtcaccgtcgtcggcggccacctcggcctacagctgaaccagaaggcactcaccaccttc
ccagacgtggtgctcgtccgggtgcccacaccctcagtgcagtcggacagtgacatcacg
gtcctgcgacacctggagaaattgggctgccgcctagtcaaccgcccacagagcatttta
aactgcatcaacaaattctggacattccaagagctggctggacatggggtgcccatgcca
gacactttctcctatggtgggcatgaagacttttcaaaaatgatcgatgaagctgagccc
ctgggctacccggttgtggtgaagagcacgcgaggacaccagggaaaagctgtttttctt
gcaagagataaacatcacatctcagacatctgccatctcatccgccatgatgtgccctac
ctgttccagaagtatgtgaaggagtcccacggaaaagatatccgggtggtggtggtaggg
ggccaggtgataggctctatgctccgctgctccacggatggacggatgcagagcaactgc
tctcttggtggtgtgggtgtcatgtgcccactgacagaacaaggcaagcagttggctatt
caggtgtccaacatcctgggcatggacttctgtggcattgatctcctcatcatggacgat
ggctcttttgtggtgtgtgaggcaaatgccaacgtcggtttcctagccttcgaccaggca
tgcaacttagatgtgggtgggatcattgcagactacaccatgtccttgctgccaaatagg
cagactgggaagatggccgtcctcccaggactgtcgagtcccagggagaagaaagagcca
gatggctgtgcttcagctcagggagttgcagaaaacgtctacaccatcaacagtgggtct
acctctagtgagagtgagcctgaactggcagagatccgagattcctcagcaagcacaaca
ggggccccgccccccatgctgcccgaacccggctacaacattaacaacaggattgcttca
gaattaaaacttaagtga

DBGET integrated database retrieval system