KEGG   Eremothecium cymbalariae: Ecym_7101
Entry
Ecym_7101         CDS       T02237                                 
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
erc  Eremothecium cymbalariae
Pathway
erc04111  Cell cycle - yeast
erc04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Ecym_7101
   04113 Meiosis - yeast
    Ecym_7101
SSDB
Motif
Pfam: Fungal_TACC HAP1_N DUF724 DUF4201 Bcr-Abl_Oligo T3SS_needle_E TPR_MLP1_2 SlyX
Other DBs
NCBI-GeneID: 11469359
NCBI-ProteinID: XP_003647770
UniProt: G8JVT8
LinkDB
Position
7:194579..196732
AA seq 717 aa
MAISTSRRGSSPVAKPLDELPTNNNFRINDAKIKLTHSPIRTHTDEDYEDIGDGGEHELQ
PPMKRIKMSSIPKLTQPESIPLISSPQPIEMLDNMDPLSLTSPIKRPHNNGAHDQDHVDQ
QDVLDIQDDIKNVVDTTPLKENGVNVFEKMTPIKPSPDDGPRNLQAELRRQDKESHEQSL
TGIDRSEDAQRSFEVQRGDWDSLSGLIDEKNATIRQLTLEIRNVQDSLWEVTKTKESFEV
SNCMQAEELKDIGKEYEQIQAQYTDVCGQKDKLEQRVDKLKARSSELKNELTMAMQNSQI
LQEKYHTQVTKNEELEHQISDKEDSVKSLETKLEHSQAQIKQLSHQLEQARDKVAEVEQN
LMDGKRAYDHQKSNAQQLESQLSEKTAKIEELTHTIEQSKDAQNRSSSELESKITDLTEE
NLILEKEYQKLLKDYDSETKALRNQIKDIYEENKSLESKYEVDCKELVSLKTQRTEFEKQ
IKNLISELEEANNELVSKKAEVNELNSTITELKQSEKYLQESIGGREQSVKDWHSKLDIK
EEELRRLNAEYESVMFKNGNMEAEHLAELEQLHENMAKFQSMLEKLTKENHDLKEVIANK
EKEELTRAESEKNEPKSSEQDEKLLTRIKDLESQLLEKDKDTNHRLQMLAEDLYIQYSSK
HEQKVKMLKKSYEVKYQESMDKLQLENSALMDEVTQLQNKVETERREKQELIKMLDK
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggcgatttctacatcccgcagaggatcatctcctgttgcgaagccgctagatgagtta
ccaactaacaataatttccggattaatgatgcgaagatcaagctgacacattcacctata
cggacacatacggatgaggactatgaggatataggtgatggcggggagcatgagctgcag
ccaccaatgaagcgtataaaaatgagttctattcctaagttaactcagccggagagtatt
cctttaatttcttcgccccagccgattgagatgctggataatatggacccgctttcgttg
accagtcctattaagagaccacataacaatggggctcatgatcaagaccatgttgatcag
caggatgttttagatattcaagatgatatcaaaaatgtcgttgatacgacgccattgaag
gagaacggtgtgaacgtgtttgagaaaatgacaccaataaagcctagcccagatgatggt
ccgcggaatttgcaagctgagttgcgccggcaagataaagagtcccacgagcagagtctt
acaggtattgataggtcagaggatgctcagcgttcatttgaagtgcagagaggcgattgg
gatagtttgtcagggctaattgatgagaaaaatgctactattagacaactaacccttgaa
attcgcaatgttcaggacagtttatgggaagtgaccaaaactaaagagtcttttgaggta
tctaattgcatgcaggctgaagagttaaaggatattggcaaagaatatgagcagatacaa
gctcaatataccgatgtatgtggccagaaggacaaacttgaacagagagtggacaaatta
aaagctagaagttccgaactcaaaaacgaactcaccatggcaatgcaaaattctcagatc
ttgcaagaaaagtaccacacacaagtgacgaagaatgaagaactggaacatcagatatca
gataaggaagattcagtcaagtcgttagagaccaagcttgaacattcgcaggcccagata
aagcaactttctcaccaattagaacaagctagagataaggtagccgaagtggagcagaac
ctaatggatggcaaaagagcatatgatcatcaaaaatcaaatgcacaacagctggaatca
cagctctctgaaaaaacagcaaagatagaagagctgacccacaccattgaacaatcaaaa
gatgctcagaacagatcttcttctgagcttgagtctaagattacagatctgactgaagaa
aatctaatactagaaaaggaataccaaaagttgcttaaagactacgactccgaaaccaaa
gctctacgcaaccaaataaaagatatttatgaggaaaataaatcattggaaagcaaatat
gaggttgattgcaaagaattggtttccctgaagacgcagcggactgaatttgagaagcaa
attaaaaacctcatttcagaactcgaggaggccaataatgaactcgtcagtaaaaaggca
gaagtaaatgaactcaactccactataaccgagctcaagcaatcagaaaaatatctgcaa
gaatccataggagggcgtgaacaatccgtgaaggactggcactcgaagttagatatcaaa
gaagaagaattgaggcgtctgaatgccgaatacgaaagcgtaatgttcaaaaatggcaac
atggaggcagaacatctagcagaacttgaacagttgcacgagaacatggctaagtttcaa
agcatgctggagaagctaaccaaagaaaatcatgatcttaaagaagtcattgctaacaaa
gagaaggaagagctaacaagagctgagtctgagaaaaatgagccaaaatcctcagaacag
gatgaaaaactcctgactcgcatcaaggacctcgagtctcagctgcttgaaaaggacaaa
gacacaaatcaccgattacagatgcttgctgaagacctctatatccagtactcatccaaa
catgaacaaaaagtcaaaatgttgaaaaagagttacgaagtgaaataccaggagtctatg
gacaaactccaattagagaattctgcattgatggatgaagttactcaacttcaaaataaa
gtggagacagaacgtcgcgagaaacaagaactgattaagatgttagataaatag

DBGET integrated database retrieval system