Erwinia sp. E602: GKQ23_21145 Help Entry GKQ23_21145       CDS       T10706                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism erwe  Erwinia sp. E602 Pathway erwe02024   Quorum sensing erwe03018   RNA degradation Brite KEGG Orthology (KO) [BR:erwe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GKQ23_21145 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GKQ23_21145 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:erwe03019]     GKQ23_21145 (hfq)    03036 Chromosome and associated proteins [BR:erwe03036]     GKQ23_21145 (hfq) Messenger RNA biogenesis [BR:erwe03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GKQ23_21145 (hfq) Chromosome and associated proteins [BR:erwe03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GKQ23_21145 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QUG77349 LinkDB All DBs Position complement(4274129..4274440) Genome browser AA seq 103 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSSNYHHGGSNQGGSSQPAQDNDDAE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcttgaacgcactgcgtcgcgaacgtgtt ccggtttcaatttatttggtcaacggcattaaactgcaggggcagatcgagtcgtttgac cagtttgttattttgctgaaaaacacggttagccagatggtgtataagcacgcgatctct accgttgtcccgtcccgtccggtctcccaccacagcaacaatgcgggtggcggaagcagc aactatcatcacggcggtagcaatcagggtgggtcttcccagcctgcacaagacaatgac gacgctgagtaa

DBGET integrated database retrieval system