Enterobacter lignolyticus SCF1: Entcl_0701 Help Entry Entcl_0701        CDS       T01342                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism esc  Enterobacter lignolyticus SCF1 Pathway esc00790   Folate biosynthesis esc01100   Metabolic pathways esc01240   Biosynthesis of cofactors Module esc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:esc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Entcl_0701 Enzymes [BR:esc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Entcl_0701  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Entcl_0701  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Entcl_0701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADO46976 UniProt:  E3G399 LinkDB All DBs Position 732609..732977 Genome browser AA seq 122 aa AA seqDB search MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAGSDDVADCLSYADISEAV VGHVEGARFALVERVAEEVAQLLLSRFSSPWVRIKVSKPGAVARAANVGVIIERSQNLKE NQ NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggatattgtatttatagagcaactttcggtaatcaccaccattggtgtttacgactgg gaacagaccatcgagcagaagctggtgttcgatatcgaaatggcgtgggacaaccgcaaa gccgccggtagcgacgatgtcgccgactgtctgagctatgcggatatcagcgaggcggtc gtcggccatgtcgaaggcgcgcgttttgcgctggtggagcgggtggcggaagaggtcgct cagcttctgctgtcgcgcttctcctcgccgtgggtgcgcattaaggtcagtaagcctggc gccgtggcgcgcgcggcgaacgtcggagtgatcatcgaacgtagccaaaatctgaaagaa aaccaataa

DBGET integrated database retrieval system