KEGG   Endosymbiont 'TC1' of Trimyema compressum: AZF37_07870
Entry
AZF37_07870       CDS       T07734                                 
Name
(GenBank) hypothetical protein
  KO
K05519  transcriptional activator of comK gene
Organism
ett  Endosymbiont 'TC1' of Trimyema compressum
Brite
KEGG Orthology (KO) [BR:ett00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ett03000]
    AZF37_07870
Transcription factors [BR:ett03000]
 Prokaryotic type
  Other transcription factors
   Others
    AZF37_07870
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AMP21089
UniProt: A0A191HWC5
LinkDB
Position
complement(1282823..1283752)
AA seq 309 aa
MKKNVILVLLCLLLAVVASSCSETKKENKVIPTTPKVGLLLMGSPSDKYSASYYGYRALK
AVEEKYGIEITYNEYVTEANAPFLLSDYSKKGYSPVIVQGEALGEAVLSAGANYPDMKFV
CIDGLVSKDNVSSYNILQEDLVEFAGAISAGLSIGNTVGYMELTGVESFKDSFEKGVKFI
KTDGTLNYQEIDSVNKDYVNEISRFDRNNINSSGLYVNSIPLEDALKNINVKGVVIGGYL
GDDPNRNGFVRLGIDYDTIYDLVYRDFLAAKPGQKSELGFKDNIFIIEDNGHIYGSLQSR
LEELKKNLR
NT seq 930 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgtaattttagtgttactctgtttactgttagctgtagtggctagtagt
tgtagtgagactaaaaaagaaaacaaagtaataccaactacaccaaaggtgggcctgttg
ttaatgggctcacctagtgataagtattcagccagttactatgggtatagagctctaaag
gctgttgaagaaaagtatggtatagaaattacatataatgaatatgtaacagaagctaat
gccccattcttattaagtgattatagtaaaaaaggatactccccagttattgttcaaggt
gaagcgttgggagaggctgtgttatctgcaggtgcaaattaccctgatatgaaatttgtg
tgcatagacggattagttagtaaagacaatgtttcttcatataatatactccaagaagat
ttagtggaatttgctggagctatatctgcaggtctttcaatagggaatactgtaggctat
atggagctaacaggtgttgaatcatttaaagacagttttgaaaaaggcgtaaaatttatt
aaaacagatggtacattaaactatcaagaaattgatagtgtgaataaagattatgttaat
gaaatatcaagatttgataggaacaatattaattcttcaggtttatatgtcaacagtatt
ccgttagaagatgctttgaaaaatattaatgtgaaaggtgtcgtaattgggggatatcta
ggagatgacccaaatcgaaatggctttgttcgacttggtattgactatgatacaatttat
gatttggtttacagagattttttagcagcaaagccgggacagaaaagtgaattaggtttt
aaagataatatctttattattgaagataatgggcatatatatggaagtctacagagtaga
ctagaagaactgaagaaaaacttaaggtaa

DBGET integrated database retrieval system