Escherichia coli UMNK88 (ETEC, porcine): UMNK88_1691 Help Entry UMNK88_1691       CDS       T02001                                  Symbol ssb Name (GenBank) single-strand binding protein   KO K03111   single-strand DNA-binding protein Organism eun  Escherichia coli UMNK88 (ETEC, porcine) Pathway eun03030   DNA replication eun03430   Mismatch repair eun03440   Homologous recombination Brite KEGG Orthology (KO) [BR:eun00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     UMNK88_1691 (ssb)    03430 Mismatch repair     UMNK88_1691 (ssb)    03440 Homologous recombination     UMNK88_1691 (ssb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:eun03032]     UMNK88_1691 (ssb)    03400 DNA repair and recombination proteins [BR:eun03400]     UMNK88_1691 (ssb)    03029 Mitochondrial biogenesis [BR:eun03029]     UMNK88_1691 (ssb) DNA replication proteins [BR:eun03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     UMNK88_1691 (ssb) DNA repair and recombination proteins [BR:eun03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      UMNK88_1691 (ssb)   TLS (translesion DNA synthesis) factors    Other SOS response factors     UMNK88_1691 (ssb) Mitochondrial biogenesis [BR:eun03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     UMNK88_1691 (ssb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB tRNA_anti-codon Motif Other DBs NCBI-ProteinID:  AEE56288 LinkDB All DBs Position 1628257..1628673 Genome browser AA seq 138 aa AA seqDB search MSLNSITLGGNIGNDMEVRYTQNGKAIGSFPLAVTNGYGDNKRVMWITCLVFGERAEKLA PHIRKGGKIVVSGRLDVRQFDRNDGTKGTAVEVAVNEFEFMNVNQQGQQQGQQQKAPPQQ QNNNGNNPPMDFDDDIPF NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgagtttaaattcaatcacgctgggcgggaatatcggtaatgatatggaagtgcgctac acgcaaaacgggaaagctattggtagttttccgttagctgtaacgaatggctacggcgat aataagcgggtaatgtggatcacttgtctggtatttggtgagcgtgcggaaaaattagcg ccgcatatccgcaagggtggaaagatagtggtaagcggtcgcctggatgttcggcagttt gaccggaacgatggcacgaaggggacggcggtcgaagtggcggttaatgagttcgaattc atgaacgtcaaccaacaaggccagcagcaaggccagcagcagaaagcgccgccgcagcag cagaataataacgggaataatccgccgatggacttcgacgacgatattcctttttag

DBGET integrated database retrieval system