Felis catus (domestic cat): 100037415 Help Entry 100037415         CDS       T02385                                  Symbol CDK6 Name (RefSeq) cyclin-dependent kinase 6   KO K02091   cyclin-dependent kinase 6 [EC:2.7.11.22] Organism fca  Felis catus (domestic cat) Pathway fca04110   Cell cycle fca04115   p53 signaling pathway fca04151   PI3K-Akt signaling pathway fca04218   Cellular senescence fca04934   Cushing syndrome fca05160   Hepatitis C fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05169   Epstein-Barr virus infection fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05206   MicroRNAs in cancer fca05212   Pancreatic cancer fca05214   Glioma fca05218   Melanoma fca05220   Chronic myeloid leukemia fca05222   Small cell lung cancer fca05223   Non-small cell lung cancer fca05224   Breast cancer fca05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100037415 (CDK6)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100037415 (CDK6)    04115 p53 signaling pathway     100037415 (CDK6)    04218 Cellular senescence     100037415 (CDK6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100037415 (CDK6)    05206 MicroRNAs in cancer     100037415 (CDK6)    05203 Viral carcinogenesis     100037415 (CDK6)   09162 Cancer: specific types    05212 Pancreatic cancer     100037415 (CDK6)    05225 Hepatocellular carcinoma     100037415 (CDK6)    05214 Glioma     100037415 (CDK6)    05220 Chronic myeloid leukemia     100037415 (CDK6)    05218 Melanoma     100037415 (CDK6)    05224 Breast cancer     100037415 (CDK6)    05222 Small cell lung cancer     100037415 (CDK6)    05223 Non-small cell lung cancer     100037415 (CDK6)   09172 Infectious disease: viral    05160 Hepatitis C     100037415 (CDK6)    05164 Influenza A     100037415 (CDK6)    05162 Measles     100037415 (CDK6)    05163 Human cytomegalovirus infection     100037415 (CDK6)    05167 Kaposi sarcoma-associated herpesvirus infection     100037415 (CDK6)    05169 Epstein-Barr virus infection     100037415 (CDK6)    05165 Human papillomavirus infection     100037415 (CDK6)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100037415 (CDK6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:fca01001]     100037415 (CDK6) Enzymes [BR:fca01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100037415 (CDK6) Protein kinases [BR:fca01001]  Serine/threonine kinases: CMGC group   CDK family    100037415 (CDK6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Haspin_kinase Kinase-like FTA2 RIO1 Motif Other DBs NCBI-GeneID:  100037415 NCBI-ProteinID:  XP_003982805 Ensembl:  ENSFCAG00000002746 LinkDB All DBs Position A2:complement(97716309..97964931) Genome browser AA seq 326 aa AA seqDB search MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF HDLERCKENLDSRLPPSQNSSEMNTA NT seq 981 nt NT seq  +upstreamnt  +downstreamnt atggagaaggacggcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg gagggcgcctatggaaaggtgttcaaggcccgggacctgaagaacggaggccggttcgtg gcgctgaagcgcgtgcgggtgcagacaggcgaggagggcatgccgctctccaccatccgc gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt gatgtatgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat gttgatcaagacctgaccacttatttggataaagtcccggagcctggagtgcccactgaa accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga gtagtgcatcgtgatctaaaaccgcagaacattctggtgaccagcagcggacaaataaaa ctggctgactttggccttgcccgcatctacagttttcagatggctcttacctcagtggtc gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccccgtg gacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt ggaagttcagacgttgatcaacttggaaaaatcttggatgtaattggactcccaggagaa gaagactggcccagagatgtcgcccttcccagacaggcttttcactcaaaatctcctcaa ccaattgagaagttcgtaacagatattgatgaacaaggcaaagacctactcctgaagtgc ctaacctttaatccggccaaaagaatatctgcctacagtgccctgtctcacccctacttc catgatctggagaggtgcaaggagaatctggattcccgtctgcctcccagccagaacagc tcagagatgaatacagcctga

Felis catus (domestic cat): 101093368 Help Entry 101093368         CDS       T02385                                  Symbol CDK2 Name (RefSeq) cyclin-dependent kinase 2 isoform X2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism fca  Felis catus (domestic cat) Pathway fca04068   FoxO signaling pathway fca04110   Cell cycle fca04114   Oocyte meiosis fca04115   p53 signaling pathway fca04151   PI3K-Akt signaling pathway fca04218   Cellular senescence fca04914   Progesterone-mediated oocyte maturation fca04934   Cushing syndrome fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05165   Human papillomavirus infection fca05166   Human T-cell leukemia virus 1 infection fca05169   Epstein-Barr virus infection fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05215   Prostate cancer fca05222   Small cell lung cancer fca05226   Gastric cancer Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     101093368 (CDK2)    04151 PI3K-Akt signaling pathway     101093368 (CDK2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101093368 (CDK2)    04114 Oocyte meiosis     101093368 (CDK2)    04115 p53 signaling pathway     101093368 (CDK2)    04218 Cellular senescence     101093368 (CDK2)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     101093368 (CDK2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101093368 (CDK2)    05203 Viral carcinogenesis     101093368 (CDK2)   09162 Cancer: specific types    05226 Gastric cancer     101093368 (CDK2)    05215 Prostate cancer     101093368 (CDK2)    05222 Small cell lung cancer     101093368 (CDK2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101093368 (CDK2)    05161 Hepatitis B     101093368 (CDK2)    05160 Hepatitis C     101093368 (CDK2)    05162 Measles     101093368 (CDK2)    05169 Epstein-Barr virus infection     101093368 (CDK2)    05165 Human papillomavirus infection     101093368 (CDK2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101093368 (CDK2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:fca01001]     101093368 (CDK2)   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fca03032]     101093368 (CDK2)    03036 Chromosome and associated proteins [BR:fca03036]     101093368 (CDK2) Enzymes [BR:fca01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      101093368 (CDK2) Protein kinases [BR:fca01001]  Serine/threonine kinases: CMGC group   CDK family    101093368 (CDK2) DNA replication proteins [BR:fca03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     101093368 (CDK2) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     101093368 (CDK2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase APH Kinase-like Motif Other DBs NCBI-GeneID:  101093368 NCBI-ProteinID:  XP_003988917 Ensembl:  ENSFCAG00000013973 UniProt:  A0A2I2V4K7 LinkDB All DBs Position B4:84603134..84608705 Genome browser AA seq 298 aa AA seqDB search MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag acagagggtgtacccagtactgctatacgagagatttctctgcttaaggagcttaaccac cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactctacctagttttt gagtttctgcaccaggatctgaagaaattcatggatgcctctgctttgactggcattcct cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattct catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc atcaagctagcagactttggactagccagagcctttggagtacctgttcgtacttacacc catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac tccacagctgtagatatctggagcctgggctgcatctttgctgagatggtgacccgccga gccctatttcctggagattccgaaatcgaccaactcttccggatcttccggactctgggg accccagatgaagtggtttggccaggagttacttctatgcctgattataagccgagtttc cccaagtgggcccggcaagattttagcaaagttgttcctcccttggatgaagatggacgg agcttgctgtcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct ctggctcaccctttcttccaggatgtgaccaagccagtgccccaccttcgactctga

Felis catus (domestic cat): 101097903 Help Entry 101097903         CDS       T02385                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4 isoform X2   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism fca  Felis catus (domestic cat) Pathway fca01522   Endocrine resistance fca04110   Cell cycle fca04115   p53 signaling pathway fca04151   PI3K-Akt signaling pathway fca04218   Cellular senescence fca04530   Tight junction fca04660   T cell receptor signaling pathway fca04933   AGE-RAGE signaling pathway in diabetic complications fca04934   Cushing syndrome fca05160   Hepatitis C fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05169   Epstein-Barr virus infection fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05212   Pancreatic cancer fca05214   Glioma fca05218   Melanoma fca05219   Bladder cancer fca05220   Chronic myeloid leukemia fca05222   Small cell lung cancer fca05223   Non-small cell lung cancer fca05224   Breast cancer fca05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     101097903 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101097903 (CDK4)    04115 p53 signaling pathway     101097903 (CDK4)    04218 Cellular senescence     101097903 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     101097903 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     101097903 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101097903 (CDK4)    05203 Viral carcinogenesis     101097903 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     101097903 (CDK4)    05225 Hepatocellular carcinoma     101097903 (CDK4)    05214 Glioma     101097903 (CDK4)    05220 Chronic myeloid leukemia     101097903 (CDK4)    05218 Melanoma     101097903 (CDK4)    05219 Bladder cancer     101097903 (CDK4)    05224 Breast cancer     101097903 (CDK4)    05222 Small cell lung cancer     101097903 (CDK4)    05223 Non-small cell lung cancer     101097903 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101097903 (CDK4)    05160 Hepatitis C     101097903 (CDK4)    05164 Influenza A     101097903 (CDK4)    05162 Measles     101097903 (CDK4)    05163 Human cytomegalovirus infection     101097903 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     101097903 (CDK4)    05169 Epstein-Barr virus infection     101097903 (CDK4)    05165 Human papillomavirus infection     101097903 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101097903 (CDK4)    04934 Cushing syndrome     101097903 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101097903 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:fca01001]     101097903 (CDK4) Enzymes [BR:fca01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      101097903 (CDK4) Protein kinases [BR:fca01001]  Serine/threonine kinases: CMGC group   CDK family    101097903 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like FTA2 Motif Other DBs NCBI-GeneID:  101097903 NCBI-ProteinID:  XP_003989014 Ensembl:  ENSFCAG00000029663 UniProt:  M3WUQ1 LinkDB All DBs Position B4:complement(86164754..86167722) Genome browser AA seq 303 aa AA seqDB search MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGASGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctactcctcgatatgagccagtggccgagattggtgttggtgcttatggaaccgtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtccct aacggaggaggtgctagcgggggccttcccatcagcacagttcgtgaggtggccttactg aggcggctggaggcttttgaacatcccaatgttgtccggctgatggatgtctgtgccact gcccgaactgaccgagagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta aggacatatctggacaaggcacccccaccaggcttgccagtggagactatcaaggatctg atgcgccagtttctaagaggcctagatttcctccatgccaactgcattgttcatcgagat ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctatcagatggcacttacacctgtggttgttacactctggtac cgtgctccggaagttcttctgcagtctacgtacgcaacacctgtggacatgtggagcgtt ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga gatgtgtctctgccccgaggagccttttcccccagaggaccccgtccagtgcagtcagtg gtacctgagttggaggagtctggagcacagctgctgctggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt aacccagagtga

DBGET integrated database retrieval system