KEGG   Felis catus (domestic cat): 100037415
Entry
100037415         CDS       T02385                                 
Symbol
CDK6
Name
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05212  Pancreatic cancer
fca05214  Glioma
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100037415 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100037415 (CDK6)
   04115 p53 signaling pathway
    100037415 (CDK6)
   04218 Cellular senescence
    100037415 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100037415 (CDK6)
   05206 MicroRNAs in cancer
    100037415 (CDK6)
   05203 Viral carcinogenesis
    100037415 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100037415 (CDK6)
   05225 Hepatocellular carcinoma
    100037415 (CDK6)
   05214 Glioma
    100037415 (CDK6)
   05220 Chronic myeloid leukemia
    100037415 (CDK6)
   05218 Melanoma
    100037415 (CDK6)
   05224 Breast cancer
    100037415 (CDK6)
   05222 Small cell lung cancer
    100037415 (CDK6)
   05223 Non-small cell lung cancer
    100037415 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100037415 (CDK6)
   05164 Influenza A
    100037415 (CDK6)
   05162 Measles
    100037415 (CDK6)
   05163 Human cytomegalovirus infection
    100037415 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100037415 (CDK6)
   05169 Epstein-Barr virus infection
    100037415 (CDK6)
   05165 Human papillomavirus infection
    100037415 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100037415 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100037415 (CDK6)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100037415 (CDK6)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100037415 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH ABC1 Kdo Haspin_kinase Kinase-like FTA2 RIO1
Other DBs
NCBI-GeneID: 100037415
NCBI-ProteinID: XP_003982805
Ensembl: ENSFCAG00000002746
LinkDB
Position
A2:complement(97716309..97964931)
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSPQPIEKFVTDIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSRLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatggaaaggtgttcaaggcccgggacctgaagaacggaggccggttcgtg
gcgctgaagcgcgtgcgggtgcagacaggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtatgcacagtgtcacgaacagacagagaaaccaaactaacattagtgtttgaacat
gttgatcaagacctgaccacttatttggataaagtcccggagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtagtgcatcgtgatctaaaaccgcagaacattctggtgaccagcagcggacaaataaaa
ctggctgactttggccttgcccgcatctacagttttcagatggctcttacctcagtggtc
gtcacgctgtggtacagagctccagaagtcttgcttcagtccagctacgccacccccgtg
gacctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagacgttgatcaacttggaaaaatcttggatgtaattggactcccaggagaa
gaagactggcccagagatgtcgcccttcccagacaggcttttcactcaaaatctcctcaa
ccaattgagaagttcgtaacagatattgatgaacaaggcaaagacctactcctgaagtgc
ctaacctttaatccggccaaaagaatatctgcctacagtgccctgtctcacccctacttc
catgatctggagaggtgcaaggagaatctggattcccgtctgcctcccagccagaacagc
tcagagatgaatacagcctga

KEGG   Felis catus (domestic cat): 101097903
Entry
101097903         CDS       T02385                                 
Symbol
CDK4
Name
(RefSeq) cyclin-dependent kinase 4 isoform X2
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04530  Tight junction
fca04660  T cell receptor signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05214  Glioma
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101097903 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101097903 (CDK4)
   04115 p53 signaling pathway
    101097903 (CDK4)
   04218 Cellular senescence
    101097903 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101097903 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101097903 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097903 (CDK4)
   05203 Viral carcinogenesis
    101097903 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101097903 (CDK4)
   05225 Hepatocellular carcinoma
    101097903 (CDK4)
   05214 Glioma
    101097903 (CDK4)
   05220 Chronic myeloid leukemia
    101097903 (CDK4)
   05218 Melanoma
    101097903 (CDK4)
   05219 Bladder cancer
    101097903 (CDK4)
   05224 Breast cancer
    101097903 (CDK4)
   05222 Small cell lung cancer
    101097903 (CDK4)
   05223 Non-small cell lung cancer
    101097903 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101097903 (CDK4)
   05160 Hepatitis C
    101097903 (CDK4)
   05164 Influenza A
    101097903 (CDK4)
   05162 Measles
    101097903 (CDK4)
   05163 Human cytomegalovirus infection
    101097903 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097903 (CDK4)
   05169 Epstein-Barr virus infection
    101097903 (CDK4)
   05165 Human papillomavirus infection
    101097903 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101097903 (CDK4)
   04934 Cushing syndrome
    101097903 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101097903 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101097903 (CDK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101097903 (CDK4)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101097903 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 101097903
NCBI-ProteinID: XP_003989014
Ensembl: ENSFCAG00000029663
UniProt: M3WUQ1
LinkDB
Position
B4:complement(86164754..86167722)
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGASGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggccgagattggtgttggtgcttatggaaccgtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtccct
aacggaggaggtgctagcgggggccttcccatcagcacagttcgtgaggtggccttactg
aggcggctggaggcttttgaacatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgaccgagagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagactatcaaggatctg
atgcgccagtttctaagaggcctagatttcctccatgccaactgcattgttcatcgagat
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctatcagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcagtctacgtacgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagaggaccccgtccagtgcagtcagtg
gtacctgagttggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system