KEGG   Felis catus (domestic cat): 100127112
Entry
100127112         CDS       T02385                                 
Symbol
MCP-1
Name
(RefSeq) C-C motif chemokine 2
  KO
K14624  C-C motif chemokine 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05135  Yersinia infection
fca05142  Chagas disease
fca05144  Malaria
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100127112 (MCP-1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100127112 (MCP-1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100127112 (MCP-1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100127112 (MCP-1)
   04657 IL-17 signaling pathway
    100127112 (MCP-1)
   04062 Chemokine signaling pathway
    100127112 (MCP-1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100127112 (MCP-1)
   05164 Influenza A
    100127112 (MCP-1)
   05168 Herpes simplex virus 1 infection
    100127112 (MCP-1)
   05163 Human cytomegalovirus infection
    100127112 (MCP-1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100127112 (MCP-1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100127112 (MCP-1)
   05142 Chagas disease
    100127112 (MCP-1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100127112 (MCP-1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100127112 (MCP-1)
   05418 Fluid shear stress and atherosclerosis
    100127112 (MCP-1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100127112 (MCP-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100127112 (MCP-1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    100127112 (MCP-1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100127112 (MCP-1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   100127112 (MCP-1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100127112
NCBI-ProteinID: XP_003996605
Ensembl: ENSFCAG00000000840
UniProt: M3VVI4
LinkDB
Position
E1:22086052..22087933
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLVSYKRVTSSKCP
KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag
gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat
aagaagatctcgatgcagaggctggtgagctataaaagagtcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag
aagtgggtcaaggattccatggcacacctggacaagaagacccaaactgcaaagccttga

KEGG   Felis catus (domestic cat): 101086511
Entry
101086511         CDS       T02385                                 
Symbol
CCL27
Name
(RefSeq) C-C motif chemokine 27
  KO
K16598  C-C motif chemokine 27
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086511 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086511 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101086511 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101086511 (CCL27)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101086511 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101086511
NCBI-ProteinID: XP_003995634
LinkDB
Position
D4:complement(58473760..58474643)
AA seq 115 aa
MKGPSPTSSLLLLLLLLTPDPGAALLLSPSITCCTQLYRQPLSNKLLRKVIRVELQEADG
DCHLQAFVLHLSRRSVCIHPQNRSLARWFERQGRRFQGILPNLNLELIGKMDQGP
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaggggccctcacccacaagcagcctccttctgctactgctgctgctgaccccagac
cctggagcagcactgctactgtcacccagcattacctgctgtactcagctctaccgccag
ccactctcgaacaagctactaaggaaagtcatccgggtggaactgcaggaagctgatggg
gactgtcacctccaggccttcgtgcttcacttgtctcgacgcagtgtctgcatccatcct
cagaaccgcagcctggctcggtggtttgagcgccaagggaggagattccagggtattctg
cctaacctgaatttggaactgatagggaaaatggaccaggggccctaa

KEGG   Felis catus (domestic cat): 101096931
Entry
101096931         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 7
  KO
K05509  C-C motif chemokine 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096931
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096931
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101096931
   04062 Chemokine signaling pathway
    101096931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096931
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101096931
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101096931
NCBI-ProteinID: XP_003996606
Ensembl: ENSFCAG00000013588
UniProt: A0A337RX34
LinkDB
Position
E1:22096953..22098794
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQALAQPEGINSPTTCCYRFTVRKIPIQKLKSYRRITSSYCP
REAVIFKTKQAKELCADPKQKWVQDFMEYLDKKTQTSKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag
gcacttgctcagccagagggaattaatagcccaaccacctgctgctatagatttaccgtt
agaaagatccccatccagaagctgaagagctacagaagaatcaccagcagctattgtccc
agggaagccgtgatcttcaagaccaaacaggccaaggagctctgtgctgaccccaagcag
aagtgggtccaggatttcatggagtacctggacaagaaaacccaaacctcaaagctatga

KEGG   Felis catus (domestic cat): 101097189
Entry
101097189         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 8
  KO
K16596  C-C motif chemokine 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101097189
   04061 Viral protein interaction with cytokine and cytokine receptor
    101097189
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101097189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101097189
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101097189
SSDB
Motif
Pfam: IL8 DUF3852 EF-hand_9
Other DBs
NCBI-GeneID: 101097189
NCBI-ProteinID: XP_003996607
Ensembl: ENSFCAG00000013594
UniProt: M3WJ48
LinkDB
Position
E1:22134162..22136163
AA seq 99 aa
MKVSAVLLCLLLTVATFSIQVLAQPGSVSIPITCCFSVVKGKIPMQKLESYTRITNIQCP
QEAVIFKTKTSREICADPKQKWVQDFMKRLDQKSQTQKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagtgcttctgtgcctgctgctcacagtggccaccttcagcatccag
gtgcttgctcagccaggttcagtttccatcccaattacctgctgcttcagtgtggtcaaa
gggaagatccctatgcagaagctagagagctacacaaggatcaccaacatccagtgtccc
caggaagctgtgatcttcaagaccaaaacatccagagagatctgtgctgaccccaagcaa
aagtgggtccaggatttcatgaagcgcctggaccaaaagtcccaaacccagaaaccttga

KEGG   Felis catus (domestic cat): 101099760
Entry
101099760         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 13
  KO
K16595  C-C motif chemokine 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101099760
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099760
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099760
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101099760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101099760
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101099760
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101099760
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101099760
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101099760
NCBI-ProteinID: XP_003996618
Ensembl: ENSFCAG00000026454
UniProt: M3X6S8
LinkDB
Position
E1:22145112..22146597
AA seq 98 aa
MRVSAALLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ
TAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag
gcgctcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacatttaacaat
aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag
acagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa
tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

KEGG   Felis catus (domestic cat): 109493846
Entry
109493846         CDS       T02385                                 
Name
(RefSeq) uncharacterized protein LOC109493846
  KO
K16598  C-C motif chemokine 27
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109493846
   04061 Viral protein interaction with cytokine and cytokine receptor
    109493846
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    109493846
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    109493846
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   109493846
SSDB
Other DBs
NCBI-GeneID: 109493846
NCBI-ProteinID: XP_019671693
UniProt: M3WPK2
LinkDB
Position
D4:complement(58477329..58479467)
AA seq 87 aa
MSGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRDRSSAHPREQKLEPLRGLMSCLSSGLG
PAPQRSGRGLPRRTPAATAQPAGALKI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtcgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggt
tgcttctactttttcccctggctgcgcatgtggcggagggacaggagctcggcgcatccg
cgggagcagaagttggagcctctgcgaggcctgatgagctgtctgtcaagcggactgggc
cctgccccccagcgctcgggtcgcggcctccctcgccgcacccccgccgccactgcccag
ccagccggtgcattaaagatttaa

DBGET integrated database retrieval system