KEGG   Felis catus (domestic cat): 100144392
Entry
100144392         CDS       T02385                                 
Symbol
ACTG1
Name
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04210  Apoptosis
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04810  Regulation of actin cytoskeleton
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
fca05014  Amyotrophic lateral sclerosis
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05164  Influenza A
fca05205  Proteoglycans in cancer
fca05225  Hepatocellular carcinoma
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05416  Viral myocarditis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100144392 (ACTG1)
   04390 Hippo signaling pathway
    100144392 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100144392 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    100144392 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100144392 (ACTG1)
   04520 Adherens junction
    100144392 (ACTG1)
   04530 Tight junction
    100144392 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100144392 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100144392 (ACTG1)
   04613 Neutrophil extracellular trap formation
    100144392 (ACTG1)
   04670 Leukocyte transendothelial migration
    100144392 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100144392 (ACTG1)
   04919 Thyroid hormone signaling pathway
    100144392 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    100144392 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100144392 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100144392 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100144392 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    100144392 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100144392 (ACTG1)
   05135 Yersinia infection
    100144392 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    100144392 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100144392 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100144392 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    100144392 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100144392 (ACTG1)
   05414 Dilated cardiomyopathy
    100144392 (ACTG1)
   05416 Viral myocarditis
    100144392 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    100144392 (ACTG1)
   03019 Messenger RNA biogenesis [BR:fca03019]
    100144392 (ACTG1)
   03036 Chromosome and associated proteins [BR:fca03036]
    100144392 (ACTG1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    100144392 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    100144392 (ACTG1)
   04147 Exosome [BR:fca04147]
    100144392 (ACTG1)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100144392 (ACTG1)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100144392 (ACTG1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100144392 (ACTG1)
    NuA4 complex
     100144392 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    100144392 (ACTG1)
   PBAF complex
    100144392 (ACTG1)
   GBAF(ncBAF) complex
    100144392 (ACTG1)
   SWR1 complex
    100144392 (ACTG1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100144392 (ACTG1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100144392 (ACTG1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   100144392 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 100144392
NCBI-ProteinID: XP_023100072
Ensembl: ENSFCAG00000026434
LinkDB
Position
E1:complement(62016652..62019461)
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaggagatcgccgcgctggtcatcgacaatggctctggcatgtgcaaggcgggc
tttgctggggacgacgccccccgagccgtgttcccgtccatcgtcgggcggccccggcac
cagggcgttatggtgggcatgggccagaaggactcctacgtgggcgacgaggcccagagc
aagcggggcatcctgaccctcaagtaccccatcgaacacggcattgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag
cacccggtgctgctcaccgaggcccccttgaacccgaaggccaaccgtgagaagatgact
cagatcatgtttgagaccttcaacaccccagccatgtacgtggccatccaggccgtgctg
tctctgtacgcttctggccgcaccactggtattgtcatggactctggggacggggtcacc
cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagtttc
accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctgtgctacgtggcc
ctggattttgagcaggagatggccacggccgcgtcctcgtcctccctggagaagagctac
gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccttccttcctgggtatggagtcctgtggcatccacgagaccaccttcaac
tccatcatgaagtgtgacgttgacatccggaaggacctctacgctaacacggtgctgtct
ggcgggaccaccatgtaccccggcatcgccgacaggatgcagaaggagatcacagctctg
gcgcccagcacgatgaagatcaagatcatcgctccccctgagcgcaagtactccgtgtgg
atcgggggctccatcctggcgtcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Felis catus (domestic cat): 101098507
Entry
101098507         CDS       T02385                                 
Symbol
ACTB
Name
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04145  Phagosome
fca04210  Apoptosis
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04670  Leukocyte transendothelial migration
fca04714  Thermogenesis
fca04810  Regulation of actin cytoskeleton
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04971  Gastric acid secretion
fca05014  Amyotrophic lateral sclerosis
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05164  Influenza A
fca05205  Proteoglycans in cancer
fca05225  Hepatocellular carcinoma
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05416  Viral myocarditis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101098507 (ACTB)
   04390 Hippo signaling pathway
    101098507 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101098507 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    101098507 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098507 (ACTB)
   04520 Adherens junction
    101098507 (ACTB)
   04530 Tight junction
    101098507 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101098507 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101098507 (ACTB)
   04613 Neutrophil extracellular trap formation
    101098507 (ACTB)
   04670 Leukocyte transendothelial migration
    101098507 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101098507 (ACTB)
   04919 Thyroid hormone signaling pathway
    101098507 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    101098507 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    101098507 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101098507 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101098507 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    101098507 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101098507 (ACTB)
   05135 Yersinia infection
    101098507 (ACTB)
   05100 Bacterial invasion of epithelial cells
    101098507 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101098507 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101098507 (ACTB)
   05410 Hypertrophic cardiomyopathy
    101098507 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101098507 (ACTB)
   05414 Dilated cardiomyopathy
    101098507 (ACTB)
   05416 Viral myocarditis
    101098507 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fca03021]
    101098507 (ACTB)
   03019 Messenger RNA biogenesis [BR:fca03019]
    101098507 (ACTB)
   03036 Chromosome and associated proteins [BR:fca03036]
    101098507 (ACTB)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101098507 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101098507 (ACTB)
   04147 Exosome [BR:fca04147]
    101098507 (ACTB)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     101098507 (ACTB)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     101098507 (ACTB)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     101098507 (ACTB)
    NuA4 complex
     101098507 (ACTB)
  Chromatin remodeling factors
   BAF complex
    101098507 (ACTB)
   PBAF complex
    101098507 (ACTB)
   GBAF(ncBAF) complex
    101098507 (ACTB)
   SWR1 complex
    101098507 (ACTB)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    101098507 (ACTB)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     101098507 (ACTB)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101098507 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 101098507
NCBI-ProteinID: XP_006941961
Ensembl: ENSFCAG00000006788
UniProt: M3WRZ7
LinkDB
Position
E3:complement(4378257..4381765)
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc
ttcgcaggcgacgatgccccacgggccgtcttcccttccatcgtggggcgcccccggcac
cagggcgtgatggtgggtatgggccagaaggactcctacgtgggcgatgaggcccagagc
aagaggggcatcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggac
gacatggagaagatctggcatcacactttctacaatgagctgcgtgtggcccccgaggag
cacccagtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg
tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacc
cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg
gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc
accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc
ttggacttcgagcaggagatggccaccgccgcgtcctcgtcctccctggagaagagctac
gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg
ctcttccagccttccttcctgggcatggaatcctgtggtatccacgaaactaccttcaac
tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct
ggggggaccaccatgtaccccggcatcgctgaccggatgcagaaggagatcaccgccctg
gcgcccagcacgatgaagatcaagatcatcgcaccccctgagcgcaagtactccgtgtgg
atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system