KEGG   Felis catus (domestic cat): 100169654
Entry
100169654         CDS       T02385                                 
Symbol
SLC26A3
Name
(RefSeq) chloride anion exchanger precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100169654 (SLC26A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100169654 (SLC26A3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100169654 (SLC26A3)
   04612 Antigen processing and presentation
    100169654 (SLC26A3)
   04658 Th1 and Th2 cell differentiation
    100169654 (SLC26A3)
   04659 Th17 cell differentiation
    100169654 (SLC26A3)
   04672 Intestinal immune network for IgA production
    100169654 (SLC26A3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100169654 (SLC26A3)
   05164 Influenza A
    100169654 (SLC26A3)
   05168 Herpes simplex virus 1 infection
    100169654 (SLC26A3)
   05169 Epstein-Barr virus infection
    100169654 (SLC26A3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100169654 (SLC26A3)
   05152 Tuberculosis
    100169654 (SLC26A3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100169654 (SLC26A3)
   05140 Leishmaniasis
    100169654 (SLC26A3)
  09163 Immune disease
   05310 Asthma
    100169654 (SLC26A3)
   05322 Systemic lupus erythematosus
    100169654 (SLC26A3)
   05323 Rheumatoid arthritis
    100169654 (SLC26A3)
   05320 Autoimmune thyroid disease
    100169654 (SLC26A3)
   05321 Inflammatory bowel disease
    100169654 (SLC26A3)
   05330 Allograft rejection
    100169654 (SLC26A3)
   05332 Graft-versus-host disease
    100169654 (SLC26A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100169654 (SLC26A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100169654 (SLC26A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100169654 (SLC26A3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100169654 (SLC26A3)
  Exosomal proteins of epithelial cells
   100169654 (SLC26A3)
  Exosomal proteins of breast milk
   100169654 (SLC26A3)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 100169654
NCBI-ProteinID: NP_001121543
Ensembl: ENSFCAG00000031500
UniProt: O19432
LinkDB
Position
B2:33667483..33672244
AA seq 254 aa
MAVSRVPVLGFCIMALLMGPQESLAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLIVGLVGIIVGTIFIIK
GMRKVNAGERQGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccgtaagtagagtcccagtgctaggattttgcatcatggctttactgatgggtcct
caggaatcattggctatcaaagaggagcatgtgatcatccaggctgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcgacggaggatgtctatgactgcaaggtggagcattggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctgatcgtgggtctggtgggcatcattgtcggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccaagggcctctgtga

KEGG   Felis catus (domestic cat): 101082653
Entry
101082653         CDS       T02385                                 
Name
(RefSeq) DLA class II histocompatibility antigen, DR-1 beta chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101082653
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082653
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082653
   04612 Antigen processing and presentation
    101082653
   04658 Th1 and Th2 cell differentiation
    101082653
   04659 Th17 cell differentiation
    101082653
   04672 Intestinal immune network for IgA production
    101082653
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082653
   05164 Influenza A
    101082653
   05168 Herpes simplex virus 1 infection
    101082653
   05169 Epstein-Barr virus infection
    101082653
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082653
   05152 Tuberculosis
    101082653
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082653
   05140 Leishmaniasis
    101082653
  09163 Immune disease
   05310 Asthma
    101082653
   05322 Systemic lupus erythematosus
    101082653
   05323 Rheumatoid arthritis
    101082653
   05320 Autoimmune thyroid disease
    101082653
   05321 Inflammatory bowel disease
    101082653
   05330 Allograft rejection
    101082653
   05332 Graft-versus-host disease
    101082653
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082653
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082653
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082653
  Exosomal proteins of epithelial cells
   101082653
  Exosomal proteins of breast milk
   101082653
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig MHC_I DUF202 C2-set_2
Other DBs
NCBI-GeneID: 101082653
NCBI-ProteinID: XP_023109545
Ensembl: ENSFCAG00000009202
LinkDB
Position
B2:33871132..33884166
AA seq 266 aa
MACLWFPRGFLMAALMVMLMVLSPPLAWARDTPPHFLNMLKAECHFTNGTEQVRFLVRCF
YNGEEYVRFDSEVGEFRAVTELGRPDAKYWNEQKDHLEQARTAVDRICRHNYGVGESFTV
QRRVEPTVTVFPSKTQPLQHHNLLVCSVNGFYPGHIEVKWFRNGQEEETGVVSTGLIRNG
DWTFQTLVMLETVPQSGEVYTCHVEHPSRTSPITVEWRVQSDSAQSKMLSGIGGFVLGLL
FLALGLFIYFRNQKGHSGLPPTGLLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcatgcctgtggttccctagaggtttcttgatggcagctctgatggtaatgctgatg
gtgctgagccctcccctggcttgggccagggataccccaccacatttcttaaatatgttg
aaggccgagtgccatttcaccaacgggacggagcaggtgcgattcctggtcagatgtttc
tataacggggaggagtatgtgcgcttcgacagcgaagtgggggagttccgggcggtgacg
gagctggggcggcctgatgccaagtactggaacgagcagaaggaccacctggagcaggcg
cggacagcggtggaccggatctgcagacacaactacggtgttggtgagagcttcacggtg
cagcggcgagttgagccgacagtgaccgtgttcccctcgaagacgcagcccctgcagcac
cacaacctcctggtctgctccgtgaatggtttctatccaggccacattgaggtcaagtgg
ttccggaacggccaggaggaggagactggggtcgtgtccacaggcctgatccgtaacgga
gactggaccttccagaccctggtgatgctggaaacagttcctcagagtggagaggtctac
acctgccacgtggagcatccaagtcgcacgagccctatcaccgtggaatggagggtacag
tctgactctgcacagagcaagatgctgagtggaatcgggggctttgttctgggtctgctc
ttccttgcgttgggtctgttcatctacttcaggaatcagaaaggacactctggacttcca
ccaacaggactcctgagctga

KEGG   Felis catus (domestic cat): 101082906
Entry
101082906         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DO beta chain isoform X2
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101082906
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082906
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101082906
   04612 Antigen processing and presentation
    101082906
   04658 Th1 and Th2 cell differentiation
    101082906
   04659 Th17 cell differentiation
    101082906
   04672 Intestinal immune network for IgA production
    101082906
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082906
   05164 Influenza A
    101082906
   05168 Herpes simplex virus 1 infection
    101082906
   05169 Epstein-Barr virus infection
    101082906
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101082906
   05152 Tuberculosis
    101082906
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082906
   05140 Leishmaniasis
    101082906
  09163 Immune disease
   05310 Asthma
    101082906
   05322 Systemic lupus erythematosus
    101082906
   05323 Rheumatoid arthritis
    101082906
   05320 Autoimmune thyroid disease
    101082906
   05321 Inflammatory bowel disease
    101082906
   05330 Allograft rejection
    101082906
   05332 Graft-versus-host disease
    101082906
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101082906
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101082906
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082906
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082906
  Exosomal proteins of epithelial cells
   101082906
  Exosomal proteins of breast milk
   101082906
SSDB
Motif
Pfam: MHC_II_beta C1-set C2-set_2 ig
Other DBs
NCBI-GeneID: 101082906
NCBI-ProteinID: XP_003986037
Ensembl: ENSFCAG00000014072
UniProt: A0A337S4K2
LinkDB
Position
B2:complement(33926028..33932186)
AA seq 282 aa
MILLSHLFFPSRMRSGWVSWMVVLQVSVIRLDSSMTQGRDSPEDFVIQAKADCYFTNGTE
KVQFVVRFIFNLEEYARFDSDVGMFVALTELGKPDAELWNNRPDILERSKASVDALCRHN
YKLGAPFTVGRKVQPEVAVYPERTPSLQHHNLLLCSVTGFYPGDIKIMWFRNGQQERVGV
MSTGLIRNGDWTFQTMVMLEMTPELGDVYTCLVNHPSLLSPISVEWRAQSAYSWRKMLSG
IAAFLLGLIFLLVGTVICLRAQKGYVETQLSGDEVSRAVPSP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgattttactgtctcacttattttttccttccagaatgcgttctgggtgggtttcctgg
atggtggttctgcaagtgagtgtaatcaggctggattcctccatgactcaaggcagagac
tctccagaagattttgtgattcaggcaaaggctgactgttacttcaccaatgggacagag
aaggtgcagtttgtggtgagattcatttttaacttggaagagtatgcacgtttcgacagc
gatgtgggaatgtttgtggcattgacagagctggggaagcctgatgctgagctgtggaac
aatcggccggatatattggagaggagtaaagcttctgtggatgcactctgcagacataac
tacaagctgggtgcacccttcactgtggggagaaaagtgcaaccagaggtggcggtgtat
ccagagaggaccccatccctgcaacaccacaatctgctgctttgctctgtgacaggtttc
tatccaggggacatcaagatcatgtggttccggaatgggcagcaggagagagtaggggtc
atgtccactggccttatcaggaatggagactggacctttcagacaatggtgatgctggaa
atgactcctgaacttggagatgtctacacctgccttgttaatcatcccagcctgctgagc
cctatttctgtggagtggagagctcagtctgcatattcttggagaaagatgctaagtgga
attgcagccttcctgcttgggctgatcttccttctggtggggactgtcatctgcctcagg
gctcagaaagggtatgtggagacgcagttgtctggtgatgaggtctcaagagcagttccc
tcaccatag

KEGG   Felis catus (domestic cat): 101084108
Entry
101084108         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101084108
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084108
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084108
   04612 Antigen processing and presentation
    101084108
   04658 Th1 and Th2 cell differentiation
    101084108
   04659 Th17 cell differentiation
    101084108
   04672 Intestinal immune network for IgA production
    101084108
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084108
   05164 Influenza A
    101084108
   05168 Herpes simplex virus 1 infection
    101084108
   05169 Epstein-Barr virus infection
    101084108
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084108
   05152 Tuberculosis
    101084108
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084108
   05140 Leishmaniasis
    101084108
  09163 Immune disease
   05310 Asthma
    101084108
   05322 Systemic lupus erythematosus
    101084108
   05323 Rheumatoid arthritis
    101084108
   05320 Autoimmune thyroid disease
    101084108
   05321 Inflammatory bowel disease
    101084108
   05330 Allograft rejection
    101084108
   05332 Graft-versus-host disease
    101084108
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084108
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084108
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084108
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084108
  Exosomal proteins of epithelial cells
   101084108
  Exosomal proteins of breast milk
   101084108
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 101084108
NCBI-ProteinID: XP_003986042
Ensembl: ENSFCAG00000009442
UniProt: A0A337S7E2
LinkDB
Position
B2:complement(34059991..34063824)
AA seq 261 aa
MDHEQRQGAALLRFLHLLWLLPHSWTAPEAPTPVWQDELQNHTFLHTMYCQDWSPNIGLS
ETYDGDQLFSFDFSQNTRVPRLPEFADWAQKLGDTSAIFFDKAFCQAMIQEIGPKLEGKI
PVSRGLPVVEVFTLKPLEFGKPNTLVCFVSNLFPPTLTVNWQHHLDPVEGVRPTFVSAVD
GLSFQAFSYLNFTPVPSDLYSCMVTHEIDSYNAIAFWVPHNALPSDLLENVLCGVAFGLG
MLGIIVGLVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atggatcatgagcagaggcagggagctgcactgctaaggtttttacacctcctgtggctg
ctgccccactcctggaccgcccctgaagctcctaccccagtgtggcaggatgaactgcaa
aaccacacgttcctgcatacgatgtactgccaggactggagtcccaacattggactctct
gaaacctatgacggagaccagcttttctccttcgacttttcccagaatacccgagtgcct
cgcctgcctgaatttgctgactgggctcagaagcttggagatacttctgccattttcttt
gacaaagcattctgccaggctatgatccaggaaatagggccaaaacttgaagggaaaatc
cctgtgtctagagggttacctgttgttgaggtgttcacgctgaagcccctggagtttgga
aagcccaacacgctggtctgttttgtcagtaatctcttcccacccacgttgacggtgaac
tggcaacatcatttggaccctgtggaaggagtcaggcccacttttgtgtcagctgtggat
ggactcagcttccaggccttttcttacttaaacttcacaccagtaccctctgacctttac
tcctgcatggtaactcatgagattgacagctacaacgcaattgccttttgggtgccccat
aatgcgctgccctctgatcttctggagaatgtgctgtgtggtgtggcctttggcctgggt
atgctgggcatcattgttggcttagtcctcatcatctacttccgaaagccttgctcaggt
gattga

KEGG   Felis catus (domestic cat): 101084962
Entry
101084962         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101084962
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084962
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101084962
   04612 Antigen processing and presentation
    101084962
   04658 Th1 and Th2 cell differentiation
    101084962
   04659 Th17 cell differentiation
    101084962
   04672 Intestinal immune network for IgA production
    101084962
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101084962
   05164 Influenza A
    101084962
   05168 Herpes simplex virus 1 infection
    101084962
   05169 Epstein-Barr virus infection
    101084962
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084962
   05152 Tuberculosis
    101084962
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101084962
   05140 Leishmaniasis
    101084962
  09163 Immune disease
   05310 Asthma
    101084962
   05322 Systemic lupus erythematosus
    101084962
   05323 Rheumatoid arthritis
    101084962
   05320 Autoimmune thyroid disease
    101084962
   05321 Inflammatory bowel disease
    101084962
   05330 Allograft rejection
    101084962
   05332 Graft-versus-host disease
    101084962
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101084962
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101084962
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084962
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084962
  Exosomal proteins of epithelial cells
   101084962
  Exosomal proteins of breast milk
   101084962
SSDB
Motif
Pfam: C1-set MHC_II_beta ig Ig_3 Ig_2 Marek_A C2-set_2
Other DBs
NCBI-GeneID: 101084962
NCBI-ProteinID: XP_023109553
Ensembl: ENSFCAG00000023854
LinkDB
Position
B2:34137935..34161918
AA seq 253 aa
MVVLRVPGAPGMAALMMSLMTLSSPLVQSRDTPELYLYQKWSVCYELNGTHRFLEQYVYN
RELFVQFDSDSAAGVFVAESELGRETAKNWNIQKVFLELRRSAVDTVCKHNFELDEGFTL
QHRVQPNVNVSPSKKGHLQHHNLLVCHVSDFYPGHIQVRWFLNGQEETAGVLSTNPIHNG
DWTFQMLVMLEMTPQQGDVYTCRVEHPSLDSPVTVEWKAQSDAARSKMLAGVGGFVLGLV
ALGVSLLLHFRSR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggtggtcctgagggtccctggggccccggggatggcagctctcatgatgtccttgatg
acgctgagctcccctttggttcagagcagagacaccccagagctttacctctaccagaag
tggagtgtctgctacgagttgaacgggacacaccgcttcctggaacaatacgtgtacaac
agagagctgttcgtccagttcgacagtgacagcgccgcgggggtgtttgtggcggagtct
gagctgggccgagaaactgccaagaactggaacatccagaaggtgttcctggagctgaga
cggagcgccgtggacacggtgtgcaagcacaacttcgagctggacgagggtttcacgctg
cagcacagagtccagcctaacgtgaacgtctccccctccaagaaggggcacctgcagcac
cacaacctgcttgtttgccatgtgtcagatttctatcccggccacattcaagtccgctgg
ttcctgaatggacaggaggaaacagctggggttttatccactaacccgatccataatgga
gactggaccttccagatgctggtgatgctggaaatgaccccccagcagggagatgtctac
acctgccgggtggagcaccccagcctggacagtcctgtcaccgtggagtggaaggcgcag
tctgatgctgcccggagcaagatgctggctggagtcggaggcttcgtgctagggctcgtg
gccctcggagtgagcctccttctccattttagaagccgctga

KEGG   Felis catus (domestic cat): 101088734
Entry
101088734         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101088734
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088734
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088734
   04612 Antigen processing and presentation
    101088734
   04658 Th1 and Th2 cell differentiation
    101088734
   04659 Th17 cell differentiation
    101088734
   04672 Intestinal immune network for IgA production
    101088734
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088734
   05164 Influenza A
    101088734
   05168 Herpes simplex virus 1 infection
    101088734
   05169 Epstein-Barr virus infection
    101088734
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088734
   05152 Tuberculosis
    101088734
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088734
   05140 Leishmaniasis
    101088734
  09163 Immune disease
   05310 Asthma
    101088734
   05322 Systemic lupus erythematosus
    101088734
   05323 Rheumatoid arthritis
    101088734
   05320 Autoimmune thyroid disease
    101088734
   05321 Inflammatory bowel disease
    101088734
   05330 Allograft rejection
    101088734
   05332 Graft-versus-host disease
    101088734
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088734
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088734
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088734
  Exosomal proteins of epithelial cells
   101088734
  Exosomal proteins of breast milk
   101088734
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 101088734
NCBI-ProteinID: XP_004001152
Ensembl: ENSFCAG00000029158
UniProt: A0A2I2UUB6
LinkDB
Position
B2:33768475..33772332
AA seq 254 aa
MAINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgacagtgctctcaaacagc
cctgtggaactgggagagcccaacattctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagaaaatgtggtatgt
gccctgggccttgtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgccgagggcctctgtga

KEGG   Felis catus (domestic cat): 101088996
Entry
101088996         CDS       T02385                                 
Symbol
DRA
Name
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain-like precursor
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101088996 (DRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101088996 (DRA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101088996 (DRA)
   04612 Antigen processing and presentation
    101088996 (DRA)
   04658 Th1 and Th2 cell differentiation
    101088996 (DRA)
   04659 Th17 cell differentiation
    101088996 (DRA)
   04672 Intestinal immune network for IgA production
    101088996 (DRA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088996 (DRA)
   05164 Influenza A
    101088996 (DRA)
   05168 Herpes simplex virus 1 infection
    101088996 (DRA)
   05169 Epstein-Barr virus infection
    101088996 (DRA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101088996 (DRA)
   05152 Tuberculosis
    101088996 (DRA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101088996 (DRA)
   05140 Leishmaniasis
    101088996 (DRA)
  09163 Immune disease
   05310 Asthma
    101088996 (DRA)
   05322 Systemic lupus erythematosus
    101088996 (DRA)
   05323 Rheumatoid arthritis
    101088996 (DRA)
   05320 Autoimmune thyroid disease
    101088996 (DRA)
   05321 Inflammatory bowel disease
    101088996 (DRA)
   05330 Allograft rejection
    101088996 (DRA)
   05332 Graft-versus-host disease
    101088996 (DRA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101088996 (DRA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101088996 (DRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101088996 (DRA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101088996 (DRA)
  Exosomal proteins of epithelial cells
   101088996 (DRA)
  Exosomal proteins of breast milk
   101088996 (DRA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 101088996
NCBI-ProteinID: NP_001295980
Ensembl: ENSFCAG00000031817
UniProt: O19434
LinkDB
Position
B2:33701347..33704873
AA seq 254 aa
MTINGVLVLGFLIVAFLMCPQESGAIKEEHVIIQAEFYLKPDSSGEFMFDFDGDEIFHVD
MEKKETVWRLEEFGRFASFEAQGALANIAVDKANLDILIKRSNNTPNTNEPPEVTVLSNS
PVELGEPNILICFIDKFSPPVINVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
SAEDVYDCKVEHWGLDEPLLKHWEFDAPTPLPETTENVVCALGLVVGLVGIIVGTIFIIK
GMRKVNAGERRGAL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaccataaatggagtcctggtgctaggatttcttatcgtggctttcctgatgtgtcct
caggaatccggggctatcaaagaggagcatgtgatcatccaggccgagttctatctgaag
cctgactcatcaggcgagtttatgtttgactttgatggtgatgagattttccatgtggat
atggaaaagaaggagacagtgtggcggcttgaagaatttggacgttttgccagctttgag
gcccagggtgccttggccaatatagctgtggacaaagctaacctggacatcttgataaag
cgctccaacaacaccccaaacaccaatgaacctcctgaggtgactgtgctctcaaacagc
cctgtggaactgggagagcccaacatcctcatctgtttcatcgacaagttctccccacca
gtgatcaatgtcacgtggcttcgaaatggaaagcctgtcaccacaggagtgtcagagacc
gtcttcctgccccgggaagaccaccttttccgcaagttccactatctccctttcctaccc
tcggcggaggatgtctatgactgcaaggtggagcactggggtttggatgagcctcttctc
aagcactgggagtttgatgcaccaacccccctcccagagacaacagagaatgtggtgtgt
gccctgggcctggtcgtgggtctggtgggcatcattgttggaaccatcttcatcatcaag
ggcatgcgcaaggtcaatgctggtgaacgcagaggcgctctgtga

KEGG   Felis catus (domestic cat): 101090265
Entry
101090265         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DM beta chain isoform X1
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090265
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090265
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090265
   04612 Antigen processing and presentation
    101090265
   04658 Th1 and Th2 cell differentiation
    101090265
   04659 Th17 cell differentiation
    101090265
   04672 Intestinal immune network for IgA production
    101090265
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090265
   05164 Influenza A
    101090265
   05168 Herpes simplex virus 1 infection
    101090265
   05169 Epstein-Barr virus infection
    101090265
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090265
   05152 Tuberculosis
    101090265
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090265
   05140 Leishmaniasis
    101090265
  09163 Immune disease
   05310 Asthma
    101090265
   05322 Systemic lupus erythematosus
    101090265
   05323 Rheumatoid arthritis
    101090265
   05320 Autoimmune thyroid disease
    101090265
   05321 Inflammatory bowel disease
    101090265
   05330 Allograft rejection
    101090265
   05332 Graft-versus-host disease
    101090265
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090265
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090265
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090265
  Exosomal proteins of epithelial cells
   101090265
  Exosomal proteins of breast milk
   101090265
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 SPARK C2-set_2 I-set
Other DBs
NCBI-GeneID: 101090265
NCBI-ProteinID: XP_023109550
Ensembl: ENSFCAG00000009694
LinkDB
Position
B2:complement(34044894..34050589)
AA seq 263 aa
MNTLLPLLLGLSLGSTRAGGFLAHVESTCLLDDDGTPKDFTYCVSFNKDLLTCWDPQTSQ
MAPCEFGVLSVLANYLSDYLNQQESLLQRLSNGLQDCATHTQSFWGSLTHRTRPPTVQVA
KTTPFNTKERVMLACYVWGFYPADVNISWRKNGQPVLPHRSAPKMAQPNGDWTYQTVSHL
ATTPSFGDTYTCVVDHIGALEPICEDWTPGLSPMQTLKVSVAAVTLGLGLIIFSLGLLSW
RKASSSGYIFLPGSSYPEGQHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaacacactcctgccgttgctgctaggcctcagcctgggctccaccagagcaggtggc
tttttagcccatgtggaaagcacctgtctgttggatgatgatgggactccaaaggatttc
acatattgtgtctccttcaacaaggatttgctgacctgctgggatcctcaaacatcccaa
atggccccttgtgaatttggggtactgagtgtcttggcgaattacctctcagattacctc
aaccaacaggaaagcctactccagcgcttgtctaatgggctccaggactgtgccacacac
acccagtccttctggggatcactgacccacaggacacggccaccaactgtgcaggtagcc
aaaaccactccttttaacacgaaggagcgtgtgatgctggcctgctacgtgtggggcttc
tatccagctgatgtgaatatctcatggaggaagaatgggcagcctgtcctccctcacaga
agtgcccctaagatggctcagcccaatggagactggacgtatcagaccgtctctcattta
gccacaactccctctttcggggacacctacacctgcgtggtggatcacatcggggctctt
gagcccatctgcgaggactggacgcctgggctgtccccgatgcagacactgaaggtttcg
gtggctgcagtgactctgggcctgggcctcatcattttctctcttggtttgctcagctgg
cggaaagctagctcctctggctacattttcctccctgggtccagttatccagaaggtcaa
cacatctcctag

KEGG   Felis catus (domestic cat): 101090518
Entry
101090518         CDS       T02385                                 
Name
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090518
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090518
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090518
   04612 Antigen processing and presentation
    101090518
   04658 Th1 and Th2 cell differentiation
    101090518
   04659 Th17 cell differentiation
    101090518
   04672 Intestinal immune network for IgA production
    101090518
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090518
   05164 Influenza A
    101090518
   05168 Herpes simplex virus 1 infection
    101090518
   05169 Epstein-Barr virus infection
    101090518
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090518
   05152 Tuberculosis
    101090518
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090518
   05140 Leishmaniasis
    101090518
  09163 Immune disease
   05310 Asthma
    101090518
   05322 Systemic lupus erythematosus
    101090518
   05323 Rheumatoid arthritis
    101090518
   05320 Autoimmune thyroid disease
    101090518
   05321 Inflammatory bowel disease
    101090518
   05330 Allograft rejection
    101090518
   05332 Graft-versus-host disease
    101090518
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090518
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090518
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090518
  Exosomal proteins of epithelial cells
   101090518
  Exosomal proteins of breast milk
   101090518
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 101090518
NCBI-ProteinID: XP_006931676
Ensembl: ENSFCAG00000009697
UniProt: M3WBX2
LinkDB
Position
B2:complement(34109007..34113747)
AA seq 250 aa
MVLSGGLVLGLHTLMSLLSPHEAGAIKADHMGSYGPAFYQSYGASGQFAYEFDGEQLFSV
ELKKREAVWRLPEFGNFAYFDPQNGLASIAVIKAHLDVLVERSNRTRATNVPPRVTVFPK
FRVELGQPNVLICMVDNIFPPVINITWLRNGQIITEGVAQTSFYSQPDHLFRKFYYLTFV
PSADDMYDCKVEHWGLDEPLFRHWEPQMPIPLPDTAETLVCALGLALGLVGFLVGTILII
RGTCLSSAPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggtcctcagtggggggctagtcctaggactccacaccttgatgagcctcctgagcccc
cacgaagccggggccatcaaggctgatcacatgggctcctatggaccagccttctaccaa
tcctatggtgcctcgggtcagtttgcctatgaatttgatggggaacagctgttctctgtg
gagctgaagaagagggaggctgtgtggcgtttgcctgagtttggcaacttcgcctacttt
gacccacagaatgggctggccagcatcgcggtgatcaaagcccatctggatgtcttggtg
gaacgctccaaccgcaccagagccaccaacgtgcctccgagggtgactgtattccccaag
tttcgagtggagctgggccagcccaacgtcctcatctgcatggtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggtcaaataatcaccgagggggtggcccag
accagcttctattcccagcctgaccatctgttccgcaagttctactacctgaccttcgtg
ccttcagcagatgacatgtatgactgcaaggtggagcactggggcctggacgagccgctc
ttcaggcactgggagccccagatgcctatcccgctgccagacaccgctgagactctggtc
tgtgcccttggcctagccctcggcctggtgggctttcttgtgggcaccattctcatcatc
agaggcacatgcttgtccagtgcccccaggtaa

KEGG   Felis catus (domestic cat): 101090771
Entry
101090771         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101090771
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101090771
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101090771
   04612 Antigen processing and presentation
    101090771
   04658 Th1 and Th2 cell differentiation
    101090771
   04659 Th17 cell differentiation
    101090771
   04672 Intestinal immune network for IgA production
    101090771
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090771
   05164 Influenza A
    101090771
   05168 Herpes simplex virus 1 infection
    101090771
   05169 Epstein-Barr virus infection
    101090771
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101090771
   05152 Tuberculosis
    101090771
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090771
   05140 Leishmaniasis
    101090771
  09163 Immune disease
   05310 Asthma
    101090771
   05322 Systemic lupus erythematosus
    101090771
   05323 Rheumatoid arthritis
    101090771
   05320 Autoimmune thyroid disease
    101090771
   05321 Inflammatory bowel disease
    101090771
   05330 Allograft rejection
    101090771
   05332 Graft-versus-host disease
    101090771
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101090771
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101090771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101090771
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101090771
  Exosomal proteins of epithelial cells
   101090771
  Exosomal proteins of breast milk
   101090771
SSDB
Motif
Pfam: MHC_II_alpha C1-set
Other DBs
NCBI-GeneID: 101090771
NCBI-ProteinID: XP_023109554
LinkDB
Position
B2:complement(34142197..34147346)
AA seq 301 aa
MHLEDIRFQTQVMILRVISLAALLSPHGTGAIKVGHVSTYVQFVQTHRPSGEYMFEFDED
EQFYVDLDKKETIWHLPEFIHAFNFDAWRGIADIVTAKKNLNTLIQRSNHTRATNEPPEV
AVFPKEPVELGQPNTLICHVDKFFPSVLNVTWLCNGQTVTKXVAESIFLPSTEFRFHKFH
YLTFIPTAEDVYDCKVEHRGLDQPLLQHWEAQEPIEVPETMETVVCALGLVVGVAGIITG
TIILKTRRPDNIPGCRGPCELSQSWGYRDTVQKRRQHGMGSGREGETLQQGFFENFAFQN
H
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcaccttgaagacataaggttccagacccaagtcatgatcctgcgagtcatctccctg
gctgcccttctgagcccccatggaactggggccatcaaggtgggccacgtgtcaacgtat
gtccagtttgtccagacacacagaccctctggagagtacatgtttgagtttgatgaggat
gagcagttctatgtggatctggataagaaggagaccatctggcatcttccagagtttatt
catgccttcaactttgatgcttggaggggtattgctgacattgtcacagcaaagaagaac
ctgaacactctgatccaacggtccaaccacaccagggccacaaatgagccacctgaggtg
gccgtgtttcccaaggaacctgtggagcttggacagcccaacaccctcatctgtcatgtg
gacaagttcttcccatctgtgctcaatgtcacatggctgtgcaatgggcagacggtcacc
aaangtgtggctgagagcatcttcctgcctagcacagaattcaggttccacaagttccac
tacctgaccttcattcccacggctgaagatgtctatgactgcaaggtggagcacaggggc
ctggaccagccgctccttcagcactgggaggcccaggagcctatcgaggtgcctgagaca
atggagactgtggtctgtgccctgggcctggtggtgggcgtggcaggcatcatcactggc
accatcatcctgaagaccaggaggcccgacaacatccctgggtgcaggggcccctgtgag
ttatcccagagctgggggtatagggacacagtgcaaaagaggaggcaacatggtatgggt
agtgggcgggaaggagaaacacttcaacaggggttctttgagaactttgcatttcagaat
cactga

DBGET integrated database retrieval system