KEGG   Felis catus (domestic cat): 100169946
Entry
100169946         CDS       T02385                                 
Symbol
KRT18
Name
(RefSeq) keratin, type I cytoskeletal 18 isoform X1
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100169946 (KRT18)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100169946 (KRT18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    100169946 (KRT18)
   04147 Exosome [BR:fca04147]
    100169946 (KRT18)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     100169946 (KRT18)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100169946 (KRT18)
  Exosomal proteins of other body fluids (saliva and urine)
   100169946 (KRT18)
  Exosomal proteins of colorectal cancer cells
   100169946 (KRT18)
  Exosomal proteins of melanoma cells
   100169946 (KRT18)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 T2SSM_b DUF4407 DUF4473
Other DBs
NCBI-GeneID: 100169946
NCBI-ProteinID: XP_003988795
Ensembl: ENSFCAG00000000299
UniProt: M3VUH3
LinkDB
Position
B4:81398110..81402204
AA seq 430 aa
MSFTTHSIFSSNYRSVGSVQGSNHRVRPVSSAASVYAGAGGSGSRISISRSSSFRSGWGS
GGMAAVMTGALAGIGGIQGEKETMQDLNDRLASYLERVRSLEADNQRLEIKIREHLEKKG
PQVRDWGHYFKTIEELRAQIFANSVDNARIVLQIDNARLAADDFRVKYETELAMRQSVES
DIHGLRKVIDDTNVTRLQLETEIEALKEELLFMKKNHEEEVKGLQNQIANSGLTVELDAP
KSQDLSKIMADIRAQYEELAKKNREELDKYWSQQIEESTTVITSQTAEIAEAEKTLKELR
RTVQSLEINLDSMRNLKASFENSLREVEARYTLQMEQLNGVLLHLESELSQTRTEGQRQA
QEYEALLNVKVKLEAEIATYRRLLEDGEDFSLSDALDTSNSFQTIQKTTTRRIVDGKVVS
ETNDTKVLRR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgagcttcaccacccactccatcttctcctccaactaccggtccgtgggctcggtgcag
gggtccaaccaccgggtccggccggtcagcagtgcagccagcgtctatgcaggcgccggg
ggctcaggctcccggatctccatatcccgctcctctagcttccggagcggctgggggtcc
gggggcatggccgccgtgatgaccggggctctggcgggcatcgggggcatccagggcgag
aaggagaccatgcaagacctgaatgaccgcctggcctcctacctggagagggtgaggagc
ctggaggctgataatcagagattggagatcaaaatccgggaacacctggagaagaaggga
cctcaggtcagagactgggggcactacttcaagaccatcgaggagctgagggctcagatc
tttgcaaattctgtggacaatgcccgcatcgttctgcagattgacaatgcccgtcttgct
gctgatgacttcagggtcaagtatgagacggagctggccatgcgccagtctgtggagagt
gacatccatgggctccgcaaggtcattgatgacaccaatgtcactcggctgcagctggag
acagagatcgaggctctcaaggaagaattgctcttcatgaagaagaaccatgaggaggaa
gtaaagggtctacaaaaccaaattgccaactcggggttgaccgtggagttggatgccccc
aaatctcaggacctcagcaagatcatggcggacatccgggcccagtatgaagagctggct
aagaagaaccgagaggagctggacaagtactggtcccagcagattgaggagagcaccaca
gtgatcacctcccagactgctgagatagcagaagctgagaagaccctcaaggagctgaga
cgcacggtccagtccttggagatcaacctggactcgatgagaaacctgaaggccagcttc
gagaacagcttgagggaggtggaggcccgctacacattgcagatggagcagctcaacggg
gtcctgctgcacctggagtcagagctgtcccagacccggacagaggggcagcggcaggcc
caggagtacgaggccttgctcaatgtcaaggtcaagctggaggctgagatcgccacctac
cgtcgcctgctggaagacggggaggacttcagtcttagcgacgccctggataccagcaac
tcctttcaaaccatccagaagaccaccacccgcaggatcgtggacggcaaagtggtgtct
gagaccaacgacaccaaagttctgaggcgttga

KEGG   Felis catus (domestic cat): 101083308
Entry
101083308         CDS       T02385                                 
Name
(RefSeq) keratin, type I cytoskeletal 26
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101083308
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101083308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101083308
   04147 Exosome [BR:fca04147]
    101083308
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101083308
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101083308
  Exosomal proteins of other body fluids (saliva and urine)
   101083308
  Exosomal proteins of colorectal cancer cells
   101083308
  Exosomal proteins of melanoma cells
   101083308
SSDB
Motif
Pfam: Filament TPR_MLP1_2
Other DBs
NCBI-GeneID: 101083308
NCBI-ProteinID: XP_006940394
Ensembl: ENSFCAG00000026580
UniProt: M3X826
LinkDB
Position
E1:complement(41631911..41637567)
AA seq 465 aa
MSFQLSGGSRRVCSRTGPGRLSGGGPGFGAGNACRGSGAGSSVSFTLGSISSGGGFCNGG
GGFSNGFLGNEHGLLSGNEKMTMQNLNDRLACYLDHVRALEEANVDLEQKIKAWYEKYGP
GSCRGLDHDHTRYFSVIEDLKRQVISMATCNASIILQNDNAKLTADDFRLKYENELALHQ
SVEADINGLHRVMDELTLCTTDLEIQFETLSEELAYLKKNHEEEMNVLQYAAGGDVNVEV
NAAPGVDLTVLLNNMRAEYEDLSEQNRKDTEAWFNEKSASLQQQISDDSGAATTARNELM
ELKRNLQTLEIELQSLVAMKHSYECSLAETEGNYCLQLQQIQDQIGAMEEELQQIRTETE
GQKLEYQQLLDIKIFLEKEIETYCKLLDGEERKSKSICYKSKGRGPIHSENQVKDSKEEI
IVKTVVEELDQLGNVLSLRVHSVEEKSSKISNITMEQRVPSKAPK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtcttttcaactttctggtggatccaggcgagtctgctcacgaactggcccagggcgg
ctgtctggtggaggtccaggtttcggggctgggaacgcatgccgtgggtctggagccgga
agcagcgtttcttttactcttgggagcatttcttctggtggaggtttctgtaatggtggt
gggggcttctctaatggttttcttggaaatgagcatggcctcctttccgggaatgaaaag
atgaccatgcaaaacctcaacgaccgcctggcatgctacctggaccacgtccgagccctc
gaggaggcaaacgtagacctggagcagaaaatcaaggcctggtacgagaaatacggaccc
ggttcttgccggggtctagatcatgaccacacgagatatttctcagtcattgaagatctt
aagagacaggttatttccatggccacgtgtaatgccagcattattctgcaaaatgacaat
gccaaactgactgctgatgacttcaggctgaagtatgaaaatgaacttgctctacaccag
agtgtagaggccgacatcaatggtcttcacagggttatggatgagctgaccctttgtaca
accgacctcgagatacagtttgaaacgctcagtgaggaattggcataccttaaaaaaaat
cacgaagaggaaatgaatgtcctacagtacgcggctgggggggatgtgaacgtggaggtg
aatgcagcgccaggcgtggacctaactgtcctgttgaacaacatgagggccgagtatgag
gacttgtctgagcagaaccgcaaagacacggaggcctggtttaatgaaaagagtgcctca
ctgcaacaacagatttctgatgattcaggagcagccaccacagctagaaatgagctgatg
gagctgaaacgcaatctgcaaaccttggaaatagaacttcagtccctcgtggccatgaaa
cattcgtatgaatgctccctggctgaaactgaaggtaattactgcctccagctccagcag
atccaggaccagattggggcaatggaggaagagttgcaacagattcgcacagaaacagaa
ggccagaagctggagtaccaacagcttctagatatcaaaatatttttagaaaaagaaata
gaaacgtattgcaaattactagatggagaagaaagaaaaagcaagtccatatgttacaaa
tcaaaaggacgtgggccaatacattccgaaaatcaagtcaaagactcaaaagaagaaatt
atcgtcaaaacagtggttgaggaactagatcaacttggcaatgtcctttccctgagggtc
cactcagttgaagaaaaatcctccaaaataagcaacattacaatggagcaaagagtacct
tctaaagcaccaaagtga

KEGG   Felis catus (domestic cat): 101083814
Entry
101083814         CDS       T02385                                 
Symbol
KRT39
Name
(RefSeq) keratin, type I cytoskeletal 39
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101083814 (KRT39)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101083814 (KRT39)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101083814 (KRT39)
   04147 Exosome [BR:fca04147]
    101083814 (KRT39)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101083814 (KRT39)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101083814 (KRT39)
  Exosomal proteins of other body fluids (saliva and urine)
   101083814 (KRT39)
  Exosomal proteins of colorectal cancer cells
   101083814 (KRT39)
  Exosomal proteins of melanoma cells
   101083814 (KRT39)
SSDB
Motif
Pfam: Filament
Other DBs
NCBI-GeneID: 101083814
NCBI-ProteinID: XP_019673410
Ensembl: ENSFCAG00000002023
UniProt: M3VXR5
LinkDB
Position
E1:complement(41813408..41822628)
AA seq 474 aa
MDTKGCTTTISSSTPHQRCSRITNFRTIFPNTSCQYGGLEANSCHPTPCFYLTPICLINN
FGACPPLDDCDWCGEGINSKEKETMQILNERLANYLEKVRILEQENTELECKIQEECSKE
LCVVCPDYRSYYATIEELQQKILCTKAENSRLVSQIDNTKLAADDLRAKYEAEVSLRQGV
EADANGLQRILNALSLAKADLEARVQSLKEELLSLKNNHEEEINSLQSQLGDRLNIEVTA
APSVDLNRVLQEMRCQYESIMETNRREVEQWFNTQMEGLNQQVVTSSQQQQFCLKDITEL
RRTMNALEIELQAQHRMRDSQECILAETEARYTALLAQIQCLIDNVEAQLAEIRCALERQ
NQEYEILLDVKSQLECEIATYRSLLESSDVELPCNPCVTTCEPSSKASTMECTAPAYNTS
SSASRGSHELCCTCRVLPQILVKIFTITQEIRDGKVISSHEHVQPCFIPRIVKA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggataccaaaggctgtacaacaactatttcttcttcaacgccacaccaaagatgctct
aggattacaaattttaggaccatctttcccaacaccagctgccaatatggtggtctcgaa
gccaacagctgccaccctactccttgcttttatctcacacccatctgcttgattaacaac
ttcggtgcctgtccccctctggatgactgcgactggtgtggtgaaggtatcaacagtaaa
gagaaagagaccatgcaaattttgaacgagcgccttgctaactacctggagaaggtgcgg
atcttggaacaagagaacactgaactggagtgcaaaatccaggaggagtgtagcaaagag
ctttgtgtcgtatgtcctgactacaggtcctactacgctaccattgaggagctccagcag
aagatcttgtgtaccaaggctgagaattccagactggtctcacaaattgacaacaccaaa
ctggctgctgatgacttgagagccaagtacgaagctgaggtgtccctacgccagggagtg
gaggcagatgccaatggcctacagcggatcctgaacgccctgagcctcgccaaggctgac
ctggaggcacgagtccagtctctgaaggaagagctcctcagccttaaaaacaaccatgaa
gaggaaatcaattccttacagagccagcttggggacagactcaacattgaagtgactgct
gccccttctgtcgatctaaaccgggttctacaagaaatgagatgtcagtatgagtccatc
atggagacaaaccgcagagaagtggaacagtggttcaacacacagatggaggggctgaac
cagcaggtggtgaccagctctcaacagcagcagttctgcctgaaggacatcactgagctg
agacgcaccatgaatgctctggagattgaactgcaggcccagcaccgaatgagagattcc
caggaatgcatcctggcggagacagaggcccgctacacggccttactggcccagatccag
tgtctgattgataatgtggaggctcagctggcagagatcaggtgtgccctagaaagacag
aaccaagaatatgagattctgctggatgtcaagtcccagctggagtgtgagattgccaca
taccgcagccttctggagagttcggatgtcgagcttccctgtaacccgtgtgtcaccaca
tgtgagccttccagtaaggccagcaccatggaatgcacagccccggcttacaatacatca
tcctcagcctcccgcggatcacatgagctctgctgtacctgcagagtactgccccaaata
ctggttaaaatcttcaccatcacgcaggagatcagggatggcaaagtcatttcttctcac
gagcacgtgcagccttgcttcatccccagaattgtcaaagcctaa

KEGG   Felis catus (domestic cat): 101084838
Entry
101084838         CDS       T02385                                 
Symbol
KRT24
Name
(RefSeq) keratin, type I cytoskeletal 24 isoform X2
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101084838 (KRT24)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101084838 (KRT24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101084838 (KRT24)
   04147 Exosome [BR:fca04147]
    101084838 (KRT24)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101084838 (KRT24)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101084838 (KRT24)
  Exosomal proteins of other body fluids (saliva and urine)
   101084838 (KRT24)
  Exosomal proteins of colorectal cancer cells
   101084838 (KRT24)
  Exosomal proteins of melanoma cells
   101084838 (KRT24)
SSDB
Motif
Pfam: Filament DUF4407 TPR_MLP1_2 APG6_N DUF4515 Nuf2_DHR10-like Bacillus_HBL
Other DBs
NCBI-GeneID: 101084838
NCBI-ProteinID: XP_003996884
Ensembl: ENSFCAG00000002015
LinkDB
Position
E1:complement(41584837..41590641)
AA seq 529 aa
MSCSSRVSSSRAGGSGSVRVSAAGSSFSSGSRCGLGGGSTRGFRGGTGGCGLSRGSSSGS
GGGFGSSVQGGFGGTSGSGAGFGGGSGFGGGSGFGGGSGFGGGSGIGGGASGGFYIYGGG
LGGGRGGGVGDGGLFSGGEKQTMQNLNDRLASYLDKVRALEEANSDLENKIKEWYDKFGP
GSGDGGSGKDCNKYYPVIEDLRNQIIAATIENAGIVLQIDNARLAADDFRLKYENELYLW
QAVEADINGLRKVLDDLTMTRSDLEVQIESLTEELAYLKKNHEEEMKTMQGSSGGDVTVE
MNAAPGTDLTKLLNDMRAQYEELAEQNRREAEEQFNKQSASLQAQISTDAGAASSAKNEI
TELRRTLQALEIELQSQTAMKSSLEATLADTEADYMAQLSENQMQISGLEEQICQIRGET
ECQNAEYEQLLNVKTCLEMEIETYHRLLDGEGGSGFGGSDFRNSGSRNTGSRNMGSRDLS
VSGDSRSGSCSGQGREANKTRVTKTIVEEVVDGKVISSQVSNVSEVKVK
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtcttgctcatctcgtgtctcctcttccagggctgggggcagcggctcggtcagggtg
tccgctgctgggagcagcttcagcagtggaagcagatgcggtctggggggtggctctacc
cggggcttccgaggaggaaccggcggctgtggcctgagtcggggatcaagcagtggctct
ggaggaggttttggtagctcggtacagggtggctttggaggcacttcaggctctggggct
ggctttggtgggggttctggctttggcgggggttctggctttggcggaggctctggcttt
ggtgggggctctggaattggggggggtgctagtggaggcttctacatctatggcggtggt
ctggggggtggcagggggggtggtgttggtgatgggggacttttctccggaggtgaaaag
caaaccatgcagaacctcaatgaccgcctggccagttacctagacaaggtcagagccctg
gaggaggccaacagtgatctggagaacaaaatcaaggagtggtatgacaaatttgggcct
gggtctggagatggtggatctggaaaagattgcaacaaatactatccagtaattgaagat
ctccggaatcagatcattgctgcaactattgagaacgctgggatcgttttgcagattgac
aatgccagattggctgctgatgacttcagactgaagtatgagaacgagctgtatctctgg
caggccgtggaggccgacatcaacggccttcggaaagttctggatgacctgaccatgaca
cgctctgacctggaggtgcagattgagagcctcaccgaggagctggcctacctgaagaag
aaccacgaggaggaaatgaagactatgcaaggaagctccggaggggacgtgaccgtggaa
atgaacgccgcccccggcaccgacctgaccaagttactgaatgacatgagggcacagtat
gaagagctggcggagcaaaatcgccgcgaggccgaggagcagttcaacaagcagagcgca
tcactgcaagcacaaatttctaccgatgccggagcagccagttctgccaagaatgagatc
acagaactgagacgtactctgcaagccctggaaattgagcttcagtcccaaacggccatg
aaaagctccctggaagcgacgctggctgacacagaagctgactacatggctcagctgtca
gagaaccagatgcagatcagcggcctggaggaacagatctgccagatccggggcgagacc
gaatgccagaacgcagaatatgagcagctgctgaacgtcaagacctgcctggagatggag
attgagacctaccaccgcctgctggatggagagggaggttctggttttggaggatctgat
tttagaaactcgggctccagaaatacaggatccagaaacatgggatctagggatttgtct
gtgtctggtgactcaagatctggaagctgctctggccaaggaagagaggcaaacaagaca
agagtgacaaagaccatcgtggaggaagtggtggacggcaaagtcatctcatctcaggtc
agcaatgtttctgaagtgaaagttaagtaa

KEGG   Felis catus (domestic cat): 101085587
Entry
101085587         CDS       T02385                                 
Symbol
KRT10
Name
(RefSeq) keratin, type I cytoskeletal 10 isoform X1
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101085587 (KRT10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101085587 (KRT10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101085587 (KRT10)
   04147 Exosome [BR:fca04147]
    101085587 (KRT10)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101085587 (KRT10)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101085587 (KRT10)
  Exosomal proteins of other body fluids (saliva and urine)
   101085587 (KRT10)
  Exosomal proteins of colorectal cancer cells
   101085587 (KRT10)
  Exosomal proteins of melanoma cells
   101085587 (KRT10)
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Bacillus_HBL 3-PAP
Other DBs
NCBI-GeneID: 101085587
NCBI-ProteinID: XP_023100531
Ensembl: ENSFCAG00000002019 ENSFCAG00000022836
LinkDB
Position
E1:complement(41665869..41688511)
AA seq 875 aa
MSVRYSSSKQYSSSRSGGGGGGGGGSSFRISSSKGSIGGGFSSGGFSGGSFSRGSSGGGC
FGGSSGGYGGLGGGFGGGGFGGGYGSSSFGGGYGGGSFGGGSFGGGGFSGGSFGGFGGGF
GGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGGSGQREPRD
YSKYYQTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVTLRQSVEADINGL
RRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLQNVSTGDVNVEMNAAPGVDLT
ELLNNMRNQYEQLAEKNRKDAEAWFNEKSKELTTEINSNIEQMSSHKSEITELRRTVQGL
EIELQSQLALKQSLEASLAETEGRYCMQLSQIQAQISSLEEQLQQIRAETECQNAEYQQL
LDIKIRLENEIQTYRSLLEGEGSSGGGGGYGGGRGGGSSGGGYGGSSGGGGGYGGGSSSG
GGHGGSGHGGSSGGSHGGGYGGGSSGGGGGHGGSSSGGGYGGGSSGGHKSSSSGSVGEPS
SKGPRYYQIIEELKNKVISSTIANANVILHMDNARLAADDFRLKYENELALHQNTEADIN
GLRRVLDELTLCRTDQELQYESLSEELRYLKKNHEEEMQALQCAAGGNVNVEMNAAPGVD
LTVLLNNMRAEYEDLAEQNRRDAEAWFNERSATLQQQISDHAGAATSARSELTDMKRNLQ
TLEIELRSLLAMKQSLECSLTETEGNYCTQLAQIQAQIGALEEQLHQVRTETEGQKLEYE
QLLDIKVHLEKEIETYCHLIDGDGNSCSKSKRFGSGGSGSSPKGVLFLELSKTTLVKTVV
EEIDQRGKVLSSRVHSIEEKTSKMTSNKTEQRVPF
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgtctgttcgatacagctcaagcaagcagtactcttcctcccgcagtggggggggagga
ggaggaggaggagggtcatccttcagaatttcaagcagcaaaggctccattggtggagga
tttagctcaggggggttcagtggtggttcttttagtcgtgggagctctggtggaggctgc
tttgggggctcatcaggtggctatggaggattaggaggaggctttggcggaggaggcttt
ggtggaggctatggaagcagcagctttggtgggggctatggaggaggcagctttggaggg
ggcagctttggtggtggtggcttcagtggaggcagctttggaggctttgggggtggattt
ggaggagatggtggccttctctccggaaatgaaaaagtaaccatgcagaatctgaatgac
cgcctggcttcctacttggacaaagtgcgggctctggaagaatcaaactatgagctagaa
ggcaaaatcaaagagtggtatgaaaagcatggcggctcaggccagagagaacctcgtgac
tatagcaaatactaccaaaccatcgatgatcttaaaaatcagatcctcaatctgacaact
gataatgccaacatcctgcttcagatcgacaatgccaggctggcagctgatgacttcaga
ttaaagtatgagaacgaggtcaccctgcgccagagcgtggaggctgacatcaatggcctg
cgcagggtgctggatgaactgaccctgaccaaggctgacttggagatgcagatcgagagc
ctgactgaagagctggcctacctgaagaagaatcatgaagaggaaatgaaagaccttcaa
aatgtgtccactggtgatgtaaatgtagaaatgaatgctgccccaggtgtcgatctgact
gaacttctgaataacatgagaaaccagtatgaacaacttgctgaaaaaaaccgcaaagac
gctgaagcctggttcaacgaaaagagcaaagaactcactacggaaatcaatagtaacatc
gaacaaatgtccagccacaaatcggagattactgaattgagacgcacggttcaaggtctg
gaaatcgaactacagtcccaactagccctgaaacaatccctggaagcctccttggcagaa
acagaaggtcgctactgtatgcagctctcccagattcaggcccagatctcctctctggag
gaacaactgcaacagattcgagctgaaaccgagtgccagaatgctgagtaccaacagctc
ctggatattaagatccgactggagaatgaaattcaaacctaccgcagcctactagaagga
gaaggaagttccggcggcggcggcggctacggcggcgggcgcggcggcggaagttccggc
ggcggctacggcggaagttccggcggcggtggcggctacggcggcggaagttccagcggt
ggcggccacggcggtagcggccacggcggtagctccggcggaagtcacgggggtggttac
ggcggcggcagctccggcggcggcggtggccacggcggcagttccagcggcggcggctac
ggtggcggcagctccggcggtcacaagtcctcgtcttctgggtccgtcggggaaccctct
tccaagggaccaagatactaccagataattgaagaacttaagaataaggttatctcttcc
actattgctaacgctaacgtaattctgcatatggacaatgccagactggctgcggatgac
ttccggctaaagtatgaaaatgagctcgcccttcaccaaaacacagaggctgacatcaac
gggctgcggagagtcctagacgaactgacgctctgcaggaccgaccaggagctgcagtac
gaatccctgagcgaagagctgaggtacctcaagaagaaccacgaagaggaaatgcaggcc
ctgcagtgcgcggcgggcgggaacgtgaacgtggagatgaacgcggcgcccggcgtggac
ctcacggtcctgctgaacaacatgcgggccgagtacgaagacctggccgagcagaaccgc
agggacgcggaggcctggttcaacgagaggagcgccaccctgcagcagcagatctccgac
cacgcgggcgcggccacttcagccaggagcgagctgaccgacatgaagcgcaacctacag
accctggagatcgagctgcggtcgctcctggcaatgaaacagtccctggagtgctccctg
accgagaccgaagggaactactgcacgcagctcgcccagatccaggctcagatcggggcc
ctggaggaacagctgcaccaggtccgaaccgagacggagggccagaaactggagtacgag
cagctgcttgacatcaaggtccacctggaaaaggaaattgagacctactgccacctgata
gatggagatgggaactcatgctccaaatcaaagcgctttggatcaggaggctcagggagt
tcacccaaaggtgttttatttctagagttatccaaaaccacattggtaaagacagtggtt
gaagagatagatcaacgtggtaaagttctttcatcaagagtccactccattgaagaaaag
acatctaaaatgaccagtaacaaaacagaacaaagggttcctttctag

KEGG   Felis catus (domestic cat): 101086103
Entry
101086103         CDS       T02385                                 
Symbol
KRT12
Name
(RefSeq) LOW QUALITY PROTEIN: keratin, type I cytoskeletal 12
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101086103 (KRT12)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086103 (KRT12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101086103 (KRT12)
   04147 Exosome [BR:fca04147]
    101086103 (KRT12)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101086103 (KRT12)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101086103 (KRT12)
  Exosomal proteins of other body fluids (saliva and urine)
   101086103 (KRT12)
  Exosomal proteins of colorectal cancer cells
   101086103 (KRT12)
  Exosomal proteins of melanoma cells
   101086103 (KRT12)
SSDB
Motif
Pfam: Filament DUF2944 TPR_MLP1_2 Tweety Jnk-SapK_ap_N DUF4763
Other DBs
NCBI-GeneID: 101086103
NCBI-ProteinID: XP_003996889
Ensembl: ENSFCAG00000002020
LinkDB
Position
E1:complement(41723813..41729657)
AA seq 507 aa
MSLSVRTSGLSRRPSSQSGTSGRARGTSASIVGSGYGGSTFGFGDSYGGGFSSASMFGSS
SGFGGGSGISFAGGLGSAYGGALGGGSGALGGGFGSLGSGFGGLGGGFGGLGIGFGGSPG
GGXGGILSGNDGGLLSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGS
GTGDPGSQSDYSKYYPLIEDLRNKIISATIGNAQLILQIDNARLAAEDFRMKYENELALR
VSVEADTNGLRRVLDELTLARADLEMQIENLREELAYLKKNHEEELQTFLAGGPGQVSVE
MDAAPGLDLTRLLNDMRAQYEAIAEQNRKDAEAWFVEKSGELRKEISINTEQLQSSKSEV
TDLRRAVQNLEIELQSQLATKKSLEDSLAEVEGDYCGQLSQVQQLIGSLEEQLLQVRADA
ERQNADHQRLLNAKARLELEIETYRRLLDGEAQGDGFDESLYVTDSKSQTQSIDSSKDPT
KSRKIKTIVQEVVNGEVVSSQVQEELI
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtccctctcagtgcgcacctctgggctctcccggcggccatcttcccagagtgggaca
tcgggcagagccaggggcacgtccgcttccatcgttggaagtggctatggggggagcacc
tttggctttggagacagctatgggggaggcttttcttctgcttccatgtttggttctagt
tctggctttggtggtggctctggaatttcctttgcaggaggactgggcagtgcttatggg
ggagccctgggaggtggttctggagccctgggaggtggctttggaagcctaggaagtggc
tttggaggcctgggaggtggctttggaggcctgggaattggatttggaggaagccccgga
ggtggcnccggaggcattctctctggcaatgatggaggccttctttctggatcagaaaag
gaaaccatgcaaaatcttaatgacagattggcctcctacctggataaggttcgagctcta
gaagaggctaatactgagctagaaaacaaaattcgagaatggtatgaaacacgaggatct
gggactggagaccccgggtcgcagagtgattacagtaaatattatccattgatcgaagac
ctcaggaataagatcatttctgccaccattggaaatgcccagctcatcctgcagattgac
aacgcgagactggctgccgaagacttcagaatgaagtatgagaacgagctggccctgcgg
gtgagtgtggaggccgacaccaacggcctgcgcagggtgctggacgagctgaccctggcc
agggccgacctggagatgcagatcgagaacctcagggaggagttggcctacctgaagaag
aatcatgaagaggagctccaaaccttcctggcaggcggcccggggcaggtcagcgtggaa
atggacgctgctccggggctggacctcaccaggctcctcaacgacatgagggcgcagtac
gaagccatcgctgagcagaatcgtaaggacgcggaggcctggttcgttgaaaagagcggg
gagctaaggaaggagatcagcatcaacacggagcagcttcagtccagcaagagcgaggtc
accgacctgaggcgcgcagttcaaaacctggagatcgagctccagtcccagctggccacg
aagaaatccctggaggactcgctggcggaagtggagggcgactactgcggccagctgtcg
caggtgcagcagctcatcggcagcctggaggagcagctgctccaggtgcgcgccgacgcc
gagcgccagaacgccgaccaccagcggctgctgaacgccaaggcccgcctggagctggag
atcgagacctaccgccgcctgctggacggcgaggcccaaggcgacggttttgatgaaagt
ttatatgtgacagactccaaatctcaaacacagtcgatcgattcctctaaagatccaacc
aaatcccggaaaatcaagacaattgtgcaggaagtggtgaatggtgaagtggtctcatct
caagttcaggaagaactaatataa

KEGG   Felis catus (domestic cat): 101086610
Entry
101086610         CDS       T02385                                 
Symbol
KRT23
Name
(RefSeq) keratin, type I cytoskeletal 23
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101086610 (KRT23)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086610 (KRT23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101086610 (KRT23)
   04147 Exosome [BR:fca04147]
    101086610 (KRT23)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101086610 (KRT23)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101086610 (KRT23)
  Exosomal proteins of other body fluids (saliva and urine)
   101086610 (KRT23)
  Exosomal proteins of colorectal cancer cells
   101086610 (KRT23)
  Exosomal proteins of melanoma cells
   101086610 (KRT23)
SSDB
Motif
Pfam: Filament POX ADIP CENP-F_leu_zip ATG16
Other DBs
NCBI-GeneID: 101086610
NCBI-ProteinID: XP_011287451
Ensembl: ENSFCAG00000002022
UniProt: M3VXR4
LinkDB
Position
E1:complement(41779742..41796375)
AA seq 422 aa
MISSHNFSQTLSGSFHGTGGSWGQLGSFPRAPSVHGGAGGVRVSLSFSSPSCLPPGGSWG
SRRGNSLPGRNGKEMMQNLNDRLASYLEKVRALEEANEQLESRILKWHEQRDPGSKQNYS
QYEENISHLQEQIMDGKQTNAQITLLIDNARMAVDDFGLKYENEHSFKKDLEIEVEGLRK
TLDDLTIVTTDLEQEVEGMRKELILMKKRHEQEMIERHVPNDFKVNVKVDATPGDDLIKI
LEDMREEYEFIIKKKHQELDTWYKEQSAAMAQEVASPAAVPSSQSDIHELKRTFQALEID
LQAQCHRKSALENMLSETQSRYSCQLRDMQYVISHYEDELTQLRHDLERQNNEYKVLLGI
KTHLEKEIATYQQLLEGESEGTMEESKSSVKASAAPKIKAITQESINGRIILSQVNEIQK
YA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgatctccagccacaactttagccagaccctctcaggctccttccatggcacaggaggc
agctggggccagctggggagcttccctcgggctcccagtgtccatgggggtgccgggggc
gtccgcgtctccctttccttcagctcgccaagctgcctgcctcctggagggtcttgggga
tccagaagaggcaattccctcccaggcaggaatgggaaggagatgatgcagaacctcaat
gaccgcctggcctcctacctggagaaggtacgtgccctggaggaggccaacgagcagctc
gagagtcgcatcctgaagtggcacgagcagagagatcctggcagtaagcaaaattactcc
cagtatgaggaaaacatcagccacctgcaggagcagatcatggatggcaagcagaccaac
gctcagatcactcttctcattgacaatgccaggatggcagtggatgacttcggcctcaag
tacgaaaatgaacactccttcaagaaagatttggaaattgaagttgaaggtctccgaaag
accttggatgatctgaccattgtcacaacagatctggaacaggaggttgaggggatgagg
aaagagctcattctcatgaagaagcgccatgaacaggaaatgatagaacgtcatgtgcca
aatgacttcaaggtcaatgtgaaggtggatgcaactccaggagatgatctaattaagatc
ctggaggatatgagagaggaatatgagtttataataaagaagaagcatcaagagttggac
acttggtataaagagcagtcagcagccatggcgcaagaagtggccagtccagcagctgtg
ccaagtagccaaagtgacatccatgagctgaagcgcactttccaggccctggagattgac
ctgcaggcgcagtgccacaggaaatctgctttagagaacatgctgtcagagacccagtcc
cggtactcctgccagctccgggacatgcaatacgtcatctcccactatgaggatgaactg
acacagctacgccatgacctggagcggcagaacaacgaatacaaggtcctcctgggcatc
aagacccacctggagaaggaaatcgccacctaccagcagctcctggagggagagagcgag
gggacgatggaagaatcaaagtcaagtgtgaaagcatctgcggctccaaagatcaaggcc
atcacacaggagagcatcaacggaagaataattctttctcaagtgaatgagatccaaaag
tatgcataa

KEGG   Felis catus (domestic cat): 101086611
Entry
101086611         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: keratin, type I cuticular Ha3-II
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101086611
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101086611
   04147 Exosome [BR:fca04147]
    101086611
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101086611
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101086611
  Exosomal proteins of other body fluids (saliva and urine)
   101086611
  Exosomal proteins of colorectal cancer cells
   101086611
  Exosomal proteins of melanoma cells
   101086611
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Lzipper-MIP1 Baculo_PEP_C Uso1_p115_C DUF5082
Other DBs
NCBI-GeneID: 101086611
NCBI-ProteinID: XP_006940406
Ensembl: ENSFCAG00000014126
LinkDB
Position
E1:complement(42166544..42173146)
AA seq 407 aa
MPYNFCLPNLSCRSTCCSRPCVPPSCHTCTLPGACNIPANVGNCGWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERENAELETRIREWCQQQVPFVCPSYQSYFRTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYETEMGLRQLVESDINGLRRILDELTLCKSDLEAQV
ESLKEELLSLKQNHEQEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRSQYEALVETNR
RDVEEWFTTQTEELNKQVVSSAEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TETEARYSSQLGQVQCMITNVESQLAEIRCDLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATTNACDKPIGPCVTNPCAPCGPRSRCGPCNTFGC
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgccttacaacttctgccttcccaacctgagctgccgctccacctgctgctcccggccc
tgcgtgccccccagctgccacacctgcaccctgcccggggcctgcaacatccccgccaac
gtgggcaactgcggctggttctgcgagggctccttcaatggcagcgagaaggagaccatg
cagttcctgaacgaccgcctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagaccaggatccgggagtggtgccagcagcaggtgcccttcgtgtgc
cccagctaccagtcctacttccggaccatcgaggagctccagcagaagatcctgtgcagc
aagtctgagaacgccaggctggtggtgcagatcgataatgccaaactggctgcggatgac
ttcagaaccaagtatgagacggagatgggcttgaggcagctggtggagtcagacatcaac
ggcctgcgcaggatcctggatgagctgactctgtgcaagtccgatctggaggcccaggtg
gagtccctgaaggaggagctgctgagcctcaagcagaaccatgagcaggaagtcaacacc
ctgcgctgccagatcggagaccgcctcaacgtggaggtggacgcggcccccaccgtggac
ctgaaccgcgtgctcaacgagaccaggagccaatatgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagaccgaggagctgaacaagcaagtggtgtcc
agtgcggagcagctgcagtcctgccaggcggagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaggcccagcacaacctgagggactccctggagaacacgctg
acggagaccgaggcgcgctacagctcccagctgggccaggtgcagtgcatgatcaccaac
gtggagtcccagctggccgagatccgctgtgacctggagcggcagaaccaggagtaccag
gtgctgctggacgtcaaggcccggctggagtgcgagatcaacacgtaccggggcctgctg
gagagcgaggactgcaagcttccctgcaacccctgcgccacgaccaatgcgtgtgacaag
cccatcgggccctgcgtcaccaatccctgcgccccgtgtggcccacgctcccgctgtggg
ccctgcaacacctttgggtgctag

KEGG   Felis catus (domestic cat): 101086860
Entry
101086860         CDS       T02385                                 
Symbol
KRT40
Name
(RefSeq) LOW QUALITY PROTEIN: keratin, type I cytoskeletal 40
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101086860 (KRT40)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086860 (KRT40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101086860 (KRT40)
   04147 Exosome [BR:fca04147]
    101086860 (KRT40)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101086860 (KRT40)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101086860 (KRT40)
  Exosomal proteins of other body fluids (saliva and urine)
   101086860 (KRT40)
  Exosomal proteins of colorectal cancer cells
   101086860 (KRT40)
  Exosomal proteins of melanoma cells
   101086860 (KRT40)
SSDB
Motif
Pfam: Filament SKA1 Phage_GP20 Cast ZapB
Other DBs
NCBI-GeneID: 101086860
NCBI-ProteinID: XP_003996892
Ensembl: ENSFCAG00000016398
LinkDB
Position
E1:complement(41831561..41837014)
AA seq 432 aa
MPSDCSPTCCSSESCATASDCVFASPCSMETTHLPSAQATSRGQTPSFLSGSRLATGCVT
PCYLAGNCHIPCLVGSGAWCEDGMFNSNEKETMQFLNDRLANYLEKVRGLEEMNAELECR
IREQCEGEVPLVCPDYQCYFDTIEDLQQKILCTKAESSRLSVSADNCKLAADDFRSKYES
WELSLRQLLETDIGGLRGILGELTLCKADLEAHVESLKDDLLCLKKNHEEEVNLLRGQLG
DRLSVELDTAPTVDLNRVLDEMRCQYETVLANNRRDVEEWFAVQTEELNQQQLCSTEQLQ
DCQTEILELKRTANALEIELQAQQSLTESLECTVAETEAQYGAQLAQMQCLIDNVENQLA
EIRCDLERQNQEYEVLLDTKARLECEINTYRGLLESEDSRLPCHPCSTTSTSDNTCEPYS
AYVVCTLENCCV
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgccttcggactgctcccctacgtgctgctcctctgaatcctgtgccacagcttccgac
tgtgtgttcgcttcaccctgttccatggaaaccactcacctccccagcgcccaagccacc
tccagaggccagacccctagcttcctatctgggtctcgcttggcaaccggctgtgtcaca
ccgtgctacttggctgggaattgtcacattccgtgcttggtggggagcggtgcttggtgt
gaggatgggatgttcaacagcaacgagaaggagacgatgcagttcctgaacgacagactc
gccaactacctggagaaggtgcgaggcctggaggagatgaacgcggagctggagtgcagg
atccgagaacagtgtgaaggggaggtccccctggtgtgccccgattatcagtgttacttc
gacaccattgaagatctccagcaaaagatcttgtgcacaaaggcagagagttctagattg
tctgtttcagctgacaactgcaaactggctgccgatgactttaggtcaaagtacgagtct
tgggaactgtctcttcgccagctgctggagacggacattggcggcctgcgtgggatcctg
ggtgagttgactctgtgcaaagccgatctggaggcccacgtggagtctctgaaggacgat
ctcctttgccttaagaaaaaccacgaagaggaggtcaacttgcttcgcggacagctgggt
gaccgactcagcgtggagctggacactgcccccaccgtcgacctcaacagggtcctggat
gagatgcgctgtcagtatgaaacggtgctcgccaacaaccgcagagacgtggaagaatgg
ttcgctgttcagacagaggagctgaatcagcagcagctgtgcagcacggagcagctgcag
gactgccagacagagatcctggaactgaaacgcacagccaacgctctggaaattgagctc
caagcacagcaaagcctgacagaatctctggaatgcactgtggcggagactgaggcccag
tacggcgcacagctggcccagatgcagtgcctgatcgataacgtggagaaccagctggcg
gagatccgctgtgacctggagcggcagaaccaggagtacgaggtgctgctggacacaaag
gcccggctggagtgtgagatcaacacgtaccggggtctccttgagagtgaggacagcagg
cttccctgtcacccatgttctaccacaagcacgtcagacaacacttgtgagccatactcc
gcgtatgtggtttgcacgctcgaaaactgctgtgtgtga

KEGG   Felis catus (domestic cat): 101086861
Entry
101086861         CDS       T02385                                 
Name
(RefSeq) keratin, type I cuticular Ha1
  KO
K07604  type I keratin, acidic
Organism
fca  Felis catus (domestic cat)
Pathway
fca04915  Estrogen signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101086861
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101086861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101086861
   04147 Exosome [BR:fca04147]
    101086861
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     101086861
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101086861
  Exosomal proteins of other body fluids (saliva and urine)
   101086861
  Exosomal proteins of colorectal cancer cells
   101086861
  Exosomal proteins of melanoma cells
   101086861
SSDB
Motif
Pfam: Filament TPR_MLP1_2 Lzipper-MIP1 Baculo_PEP_C Snapin_Pallidin Rho_Binding DUF5082 FliD_C
Other DBs
NCBI-GeneID: 101086861
NCBI-ProteinID: XP_006940405
Ensembl: ENSFCAG00000001920
LinkDB
Position
E1:complement(42183577..42187378)
AA seq 393 aa
MPYNCCLPNLSCRSTCCSRPCVPPSCHTCTLPGACNIPANVGNCGWFCEGAFNGSEKETM
QFLNDRLASYLEKVRQLERENAELETRIREWCQQQVPFVCPSYQSYFRTIEELQQKILCA
KSENARLVVQIDNAKLASDDFRTKYETELGLRQLVESDINGLRRILDELTLCKSDLEAQV
ESLREELLSLKKNHEEEVNTLRCQIGDRLNVEVDAAPTVDLNRVLNETRSQYEALVETNR
RDVEEWFTTQTEELNKQVVSSAEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TETEARYSSQLGQVQCMITNVESQLAEIRCDLERQNQEYQVLLDVKARLECEINTYRGLL
ESEDCKLPCNPCATTNACGNSCGSCGASQTRCS
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgccttacaactgctgccttcccaacctgagctgccgctccacctgctgctcccggccc
tgcgtgccccccagctgccacacctgcaccctgcccggggcctgcaacatccccgccaac
gtgggcaactgcggctggttctgcgaaggcgccttcaatggcagcgagaaggagaccatg
cagttcctgaacgaccgcctggccagctacctggagaaggtgcgccagctggagcgggag
aacgcggagctggagaccaggatccgggagtggtgccagcagcaggtgcccttcgtgtgc
cccagctaccagtcctacttccggaccatcgaggagctccagcagaagattctgtgtgcc
aagtctgagaatgccaggctggtggtgcagattgacaacgccaagttggcctctgatgac
ttcagaaccaagtacgagacggagctgggcttgaggcagctggtggagtcggacatcaac
ggcctgcgcaggatcctggacgagctgactctgtgcaagtctgacctggaggcccaggtg
gagtccctgagggaggagctgctgagcctcaagaagaaccacgaggaggaagtcaacacc
ctgcgctgccagatcggagaccgcctcaacgtggaggtggacgcggcccccaccgtggac
ctgaaccgcgtgctcaacgagaccaggagccaatatgaggccctggtggagaccaaccgc
agggacgtggaggaatggttcaccacccagaccgaggagctgaacaagcaagtggtgtcc
agtgcggagcagctgcagtcctgccaggcggagatcatcgagctgagacgcacggtcaac
gccctggagatcgagctgcaggcccagcacaacctgagggactccctggagaacacgctg
acggagaccgaggcgcgctacagctcccagctgggccaggtgcagtgcatgatcaccaac
gtggagtcccagctggccgagatccgctgtgacctggagcggcagaaccaggagtaccag
gtgctgctggacgtcaaggcccggctggagtgcgagatcaacacgtaccggggcctgttg
gagagcgaggattgcaagcttccctgcaacccatgtgctaccaccaacgcttgtggcaat
tcctgtgggtcctgtggtgcctctcaaacgcgttgctcttaa

DBGET integrated database retrieval system