Felis catus (domestic cat): 100169960 Help Entry 100169960         CDS       T02385                                  Symbol H3F3A Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100169960 (H3F3A)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100169960 (H3F3A)   09163 Immune disease    05322 Systemic lupus erythematosus     100169960 (H3F3A)   09165 Substance dependence    05034 Alcoholism     100169960 (H3F3A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     100169960 (H3F3A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     100169960 (H3F3A) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100169960 (H3F3A) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100169960 (H3F3A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100169960 NCBI-ProteinID:  XP_023103082 LinkDB All DBs Position F1:2103214..2111431 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccgggggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgcgaaattagacgttaccagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggctatcggtgctttgcaggaggcaagcgaggcctac ctggtgggcctcttcgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagagcgtgcttaa

Felis catus (domestic cat): 101080632 Help Entry 101080632         CDS       T02385                                  Name (RefSeq) histone H3.1 isoform X2   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080632  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101080632   09163 Immune disease    05322 Systemic lupus erythematosus     101080632   09165 Substance dependence    05034 Alcoholism     101080632  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080632   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080632 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080632 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080632 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101080632 NCBI-ProteinID:  XP_011280366 UniProt:  M3XAW8 LinkDB All DBs Position B2:2708065..2716601 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

Felis catus (domestic cat): 101080845 Help Entry 101080845         CDS       T02385                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080845  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101080845   09163 Immune disease    05322 Systemic lupus erythematosus     101080845   09165 Substance dependence    05034 Alcoholism     101080845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080845   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080845 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080845 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101080845 NCBI-ProteinID:  XP_003997209 UniProt:  M3X0X3 LinkDB All DBs Position E1:complement(56114614..56117994) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagacggctcgtaaatctacgggtgggaaagcgccccgtaagcag ctggccactaaagccgccaggaaaagtgctccctctactggcggggtgaaaaaacctcat cgctacaggcccgggaccgttgcgcttcgagagatccgtcgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagtgccgccattggtgcgctgcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

Felis catus (domestic cat): 101080886 Help Entry 101080886         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080886  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101080886   09163 Immune disease    05322 Systemic lupus erythematosus     101080886   09165 Substance dependence    05034 Alcoholism     101080886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080886   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080886 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080886 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101080886 NCBI-ProteinID:  XP_006931427 Ensembl:  ENSFCAG00000041102 UniProt:  M3XAW8 LinkDB All DBs Position B2:2708065..2723099 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgtggggagcgggcataa

Felis catus (domestic cat): 101084194 Help Entry 101084194         CDS       T02385                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084194  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101084194   09163 Immune disease    05322 Systemic lupus erythematosus     101084194   09165 Substance dependence    05034 Alcoholism     101084194  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084194   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101084194 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084194 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101084194 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101084194 NCBI-ProteinID:  XP_003985814 Ensembl:  ENSFCAG00000044044 LinkDB All DBs Position B2:3678882..3685854 Genome browser AA seq 140 aa AA seqDB search MPFRTAGTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAK RVTIMPKDIQLARRIRGEPA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgcccttcaggacggctggcacgaagcagacggcgcgcaagtcgacgggcggcaaggcc ccgcgcaagcagctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtc aagaagccgcaccgctaccggcccggcacggtggccctgcgcgagatccgccgctaccag aagtccaccgagctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcg caggacttcaagaccgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcg tgcgaggcctacctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaag cgcgtcaccatcatgcccaaggacatccagctggcgcgccgcatccgtggggagccggcc taa

Felis catus (domestic cat): 101084959 Help Entry 101084959         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084959  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101084959   09163 Immune disease    05322 Systemic lupus erythematosus     101084959   09165 Substance dependence    05034 Alcoholism     101084959  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084959   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101084959 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084959 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101084959 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101084959 NCBI-ProteinID:  XP_003985741 UniProt:  M3XAW8 LinkDB All DBs Position B2:2764281..2764890 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcctga

Felis catus (domestic cat): 101089008 Help Entry 101089008         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101089008  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101089008   09163 Immune disease    05322 Systemic lupus erythematosus     101089008   09165 Substance dependence    05034 Alcoholism     101089008  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101089008   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101089008 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101089008 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101089008 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101089008 NCBI-ProteinID:  NP_001361500 LinkDB All DBs Position B2:3626868..3627324 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

Felis catus (domestic cat): 101089514 Help Entry 101089514         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101089514  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101089514   09163 Immune disease    05322 Systemic lupus erythematosus     101089514   09165 Substance dependence    05034 Alcoholism     101089514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101089514   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101089514 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101089514 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101089514 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101089514 NCBI-ProteinID:  XP_006931452 Ensembl:  ENSFCAG00000043388 UniProt:  M3XAW8 LinkDB All DBs Position B2:complement(3660101..3661952) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

Felis catus (domestic cat): 101093269 Help Entry 101093269         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101093269  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101093269   09163 Immune disease    05322 Systemic lupus erythematosus     101093269   09165 Substance dependence    05034 Alcoholism     101093269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101093269   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101093269 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101093269 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101093269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101093269 NCBI-ProteinID:  XP_003985773 UniProt:  M3XAW8 LinkDB All DBs Position B2:complement(3835095..3835574) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgtgcgtaa

Felis catus (domestic cat): 101094506 Help Entry 101094506         CDS       T02385                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05202   Transcriptional misregulation in cancer fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101094506  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101094506   09163 Immune disease    05322 Systemic lupus erythematosus     101094506   09165 Substance dependence    05034 Alcoholism     101094506  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101094506   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101094506 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101094506 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101094506 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101094506 NCBI-ProteinID:  NP_001361502 LinkDB All DBs Position B2:3848194..3848636 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcgcggaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaagacatccagctggcgcgccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system