KEGG   Felis catus (domestic cat): 100174787
Entry
100174787         CDS       T02385                                 
Symbol
ISG15
Name
(RefSeq) ubiquitin-like protein ISG15
  KO
K12159  ubiquitin cross-reactive protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04622  RIG-I-like receptor signaling pathway
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100174787 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100174787 (ISG15)
   05169 Epstein-Barr virus infection
    100174787 (ISG15)
   05165 Human papillomavirus infection
    100174787 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    100174787 (ISG15)
Ubiquitin system [BR:fca04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100174787 (ISG15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 FeoA
Other DBs
NCBI-GeneID: 100174787
NCBI-ProteinID: NP_001124315
UniProt: B3IX46
LinkDB
Position
C1:135976..137092
AA seq 157 aa
MGGDLKVKMLGGEEFLVPLRDNMLVSELKQQIAQKTGVPAFQQRLATHPAGTVLRDGVSL
LSQGLSPGSTVLLVVQSCKDPLSILVRNHKGRTIAYEVRLTQTVAELKQQICQQEHVQAD
LFWLNFEGKPMEDQHRLGEYELTPQCTLIMNLRLRGG
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggcggggacctgaaggtgaaaatgctggggggtgaggagttcctggtgcccctgaga
gacaacatgctggtgtcggagctgaagcagcagatcgcccagaaaactggcgtgcccgca
ttccagcagagactggccacccaccctgccggcacagtgctgcgcgatggggtttccctc
ctcagccagggcctgagccccggcagcacggtcctgctggtggtgcagagctgcaaggac
cccctgagcatcctggtgaggaaccacaagggtcgcaccattgcctacgaggtccggctg
acgcagacggtggctgagctcaagcagcagatatgccagcaggagcatgtgcaggccgac
ctgttctggctgaacttcgaggggaagcccatggaggaccagcaccggcttggggagtat
gaactcacaccccagtgcactctgatcatgaatttgcgcctgcggggtgggtga

DBGET integrated database retrieval system