KEGG   Felis catus (domestic cat): 100216332
Entry
100216332         CDS       T02385                                 
Symbol
SLC17A7
Name
(RefSeq) vesicular glutamate transporter 1
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04721  Synaptic vesicle cycle
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100216332 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    100216332 (SLC17A7)
   04721 Synaptic vesicle cycle
    100216332 (SLC17A7)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    100216332 (SLC17A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    100216332 (SLC17A7)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   100216332 (SLC17A7)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    100216332 (SLC17A7)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 100216332
NCBI-ProteinID: XP_023101025
Ensembl: ENSFCAG00000023749
LinkDB
Position
E2:8524258..8534694
AA seq 560 aa
MEFRQEEFRKLAGRALGRLHRLLEKRQEGSETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEAEPPGAPPAPPPS
YGATHSTVQPPRPPPPVRDY
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagttccgtcaggaggagtttcggaagctagcgggtcgcgccctcgggaggctgcac
cgccttctggagaagcggcaggaaggttcagagacgctagagctgagtgcggacgggcgc
ccggtgacgacgcagacccgggacccgccggtagtggactgcacctgtttcggtctccct
cgccgctacattatcgccatcatgagcggtctgggcttctgcatcagctttgggatccgc
tgcaacctgggcgtggccatcgtctccatggtcaacaacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagctcaatttaactgggatccagagactgttggcctcatacac
ggctcctttttctggggctacattgtcacccagattcccggaggatttatttgccagaaa
ttcgcagccaacagggttttcggctttgctattgtggctacatccactctaaacatgctg
atcccctcggctgcccgagtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacgtaccccgcctgccacgggatctggagcaaatgggccccgccc
ctagagcggagtcgcttggcaacaacagccttctgcggttcctatgctggggcggtggtc
gcgatgcctctcgccggggtcctggtgcagtactcaggatggagctctgtgttctacgtc
tacggcagcttcgggatcttttggtacctgttctggctgctcgtctcctacgagtccccg
gctctgcaccccagcatttcggaagaggagcgcaagtacatcgaggacgccatcggcgag
agcgccaaactcatgaacccggtcacgaagtttaacacaccctggcggcgcttctttact
tccatgccagtctacgccatcatcgtggctaacttctgccgcagttggacgttctacctg
ctccttatctcccagcccgcctacttcgaagaggtgttcggcttcgagatcagcaaggtg
ggcctggtgtcagcgttgccccatctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgaggagccgccgcatcatgtccacgactaacgtgcgcaagttgatg
aactgtggaggcttcggcatggaagccacgctgctgctggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctcgccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatcgccccgcgctatgccagcatcctcatgggcatc
tccaacggcgtgggcacgttgtcaggcatggtgtgccccatcatcgtgggtgccatgact
aagcacaagactcgggaagagtggcagtacgtattcctaatcgcctccctggtgcactat
gggggtgtcatcttctacggggtcttcgcttctggagagaagcagccgtgggcggagcct
gaggagatgagcgaagagaagtgtggcttcgttggccacgaccagctggctggcagtgac
gaaagcgaaatggaggatgaggctgaaccccccggggcaccccctgctccccctccttcc
tatggggccacacacagcacagttcagcccccaagacccccaccccctgtccgggactac
tga

KEGG   Felis catus (domestic cat): 101096579
Entry
101096579         CDS       T02385                                 
Symbol
SLC17A8
Name
(RefSeq) vesicular glutamate transporter 3
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04721  Synaptic vesicle cycle
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101096579 (SLC17A8)
   04723 Retrograde endocannabinoid signaling
    101096579 (SLC17A8)
   04721 Synaptic vesicle cycle
    101096579 (SLC17A8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    101096579 (SLC17A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101096579 (SLC17A8)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   101096579 (SLC17A8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    101096579 (SLC17A8)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 101096579
NCBI-ProteinID: XP_003989207
Ensembl: ENSFCAG00000018638
UniProt: M3WNE7
LinkDB
Position
B4:123152450..123202459
AA seq 589 aa
MPFKAFDTFKEKILKPGKEGVKNAVGDSLGILQRKIDGTNDEEDNTELNEEGRPVQTSRQ
RPPLCNCHCCGIPKRYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMGVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGV
LVQYIGWASVFYIYGMFGIIWYTFWLLQAYECPAAHPTISSEERTYIETSIGEGANVVSL
SKFNTPWKKFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIIVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQEWADPENLSEEKCGIIDQDELAEETELNHESFA
SPKKKMSYGATTQNCEVQKEKWRGQRGVTLDEEELTSYQNEEGNFSDTA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccttttaaagcatttgataccttcaaagaaaaaattttgaaacctggaaaggaagga
gtgaagaacgccgtgggagattcgttggggattttacaaagaaaaatcgatgggaccaat
gatgaagaagataacactgagctgaatgaagaaggaaggccagtgcagacttccaggcag
aggcccccactctgcaactgccactgctgtggcatccccaagcgttacatcattgccatt
atgagtgggctgggattctgcatttcctttgggattcgctgcaatcttggagttgccatt
gtggaaatggtcaacaacagcactgtatatgttgatggaaaaccagaaattcagacagca
cagttcaattgggatccagagacagtgggccttatccatggatcttttttctggggttat
attgtgacacaaattccaggtggtttcatttcaaataagtttgctgctaacagggtcttt
ggagctgccatcttcttaacatcaaccttgaacatgttcatcccttctgcagccagagtg
cattacggctgtgtcatgggtgtcagaattttgcaaggtctagtggagggtgtgacttac
ccagcctgccatgggatgtggagtaagtgggcaccacctttggagagaagccgactggcc
acaacctctttttgtggttcctatgcgggggcagtgattgccatgcctctggctggggtg
ttggtacagtacattggatgggcctctgtcttttatatttatggtatgtttgggattatt
tggtacacattttggctgctgcaggcctatgaatgtcccgctgctcacccaacaatatcc
agtgaggagaggacctacatagagacaagtataggagaaggagccaacgtggttagtctc
agtaaatttaacacaccatggaaaaaatttttcacatcgttgccagtttatgcaatcatt
gtggcaaatttttgcagaagctggaccttttatttgctgttaataagtcagcctgcttat
tttgaagaggtctttggatttgcaataagtaaggtgggtctcttgtcagcagtcccacac
atggttatgaccatcattgtgccgattggaggacaattggctgattatttaagaagcaga
aaaattttgaccacaactgctgtcagaaaaatcatgaactgtggaggttttggcatggag
gcaaccttactcctggtggttggcttttcccataccaaaggggtggccatctcctttctg
gtgcttgctgtaggatttagtggctttgctatttcaggttttaacgtcaaccacctggac
attgccccgcgctatgccagcattctcatggggatctcaaatggagtgggaactctctct
ggaatggtctgtcccctcattgtcggtgcaatgaccaagcacaagactcgtgaggaatgg
cagaatgtgttcctcatagctgccctggtgcactacagtggcgtgatcttctatggggtc
tttgcttctggggagaaacaggaatgggctgaccctgagaatctgtctgaggagaagtgt
ggaatcattgaccaagatgagttagctgaggagacagaactcaaccatgagagttttgca
agtcccaaaaagaagatgtcttatggtgccaccacccagaattgtgaagtccagaaggag
aaatggagaggacagagaggagtgaccctcgatgaggaagagctgacgtcctaccagaat
gaagagggaaacttctcagacacagcctag

KEGG   Felis catus (domestic cat): 101098576
Entry
101098576         CDS       T02385                                 
Symbol
SLC17A6
Name
(RefSeq) vesicular glutamate transporter 2
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04721  Synaptic vesicle cycle
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    101098576 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    101098576 (SLC17A6)
   04721 Synaptic vesicle cycle
    101098576 (SLC17A6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    101098576 (SLC17A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101098576 (SLC17A6)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   101098576 (SLC17A6)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    101098576 (SLC17A6)
SSDB
Motif
Pfam: MFS_1 BT1
Other DBs
NCBI-GeneID: 101098576
NCBI-ProteinID: XP_011285048
Ensembl: ENSFCAG00000027200
UniProt: M3WQB5
LinkDB
Position
D1:79701973..79743644
AA seq 582 aa
MESVKQRILTPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPEKKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMIWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPNGWEKKEEFVQEEVQDSYTYKDRDDYS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagtcggtaaaacaaaggattttgaccccaggaaaagaggggctaaagaattttgct
ggaaaatcccttggccagatctacagggtgctggagaagaagcaagacactggggagacc
atcgagctgacggaggatgggaagcccctggaggtgcccgagaaaaaggctccactgtgc
gattgcacctgcttcggcctgccgcgccgctacatcatcgccatcatgagcggcctgggc
ttctgcatctccttcggcatccgctgcaacctgggcgtggccatcgtggacatggtcaac
aacagcacaatccaccgagggggcaaggtcatcaaggagaaggccaaattcaactgggac
ccagaaaccgtggggatgatccacggttccttcttttggggctacatcatcacccagatt
ccgggcggctacatcgcgtctcggctggcagccaacagggtttttggagctgccatactt
cttacctctactctgaatatgctaatcccatcagcagccagagtgcattatgggtgtgtc
atctttgttaggatattgcagggacttgttgagggcgtcacctacccagcatgtcatggg
atatggagcaaatgggctcctcctctagagaggagtagattggcaaccacctccttttgt
ggttcatatgctggagctgtgattgcaatgcctttagctggcattcttgtacagtatact
ggttggtcgtcagtattctatgtctatggaagctttggaatgatctggtacatgttttgg
cttttggtgtcttatgagagtcctgcaaagcatcctaccattacagatgaagaacgtagg
tacattgaagaaagcattggagagagtgcaaatcttttaggtgcaatggaaaaattcaag
actccatggaggaaattttttacatctatgcctgtctatgcaataattgttgcaaacttc
tgcagaagctggactttttacttattgcttattagtcagccggcatattttgaagaagtc
tttggatttgaaatcagcaaggttggcatgctatctgctgtgccacacttggtaatgaca
attattgtacccattggagggcagattgcagattttctaagaagcaagcaaattctttca
acaactacagtaagaaagatcatgaattgtggtggttttggcatggaagcaacactgctt
ctggttgttggctattctcatactagaggtgtagctatctcattcttggtacttgcagtg
ggattcagtggatttgctatttctggtttcaatgttaaccacttggatattgctccgaga
tatgcaagtatcttaatgggcatttcaaatggtgttggcacattgtcaggaatggtttgc
cctatcattgttggtgcaatgacaaagaataagtcacgtgaagagtggcagtatgttttc
ctgattgctgccctggtccactatggcggagttatattttacgcaatatttgcctcagga
gagaagcaaccctgggcagaccctgaagaaacaagtgaagaaaaatgtggatttatccat
gaagatgagcttgatgaagagacaggggacattactcaaaattatataaattatggtacc
accaagtcttatggtgccacaacacaggccaatggaggttggccaaatggttgggaaaag
aaagaggaattcgtacaagaagaagtacaagactcatacacctataaggaccgagatgat
tattcataa

DBGET integrated database retrieval system