KEGG   Felis catus (domestic cat): 100302539
Entry
100302539         CDS       T02385                                 
Symbol
THPO
Name
(RefSeq) thrombopoietin precursor
  KO
K06854  thrombopoietin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100302539 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302539 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100302539 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100302539 (THPO)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  CSF and other factors
   100302539 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100302539
NCBI-ProteinID: NP_001157128
Ensembl: ENSFCAG00000007798
UniProt: C6EMY5
LinkDB
Position
C2:85183594..85189552
AA seq 349 aa
MELTELLLVVMLLLTARLNLCLPAPPACDPRLLNKLLRDSHVLHSKLSQCPDVNPLSTPV
LLPAVDFSLGEWKTQKEQTKAQDVLGAATLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQGLLGTQLPPQGRTTAHKDPNAIFLSFQQLLRGKVRFLLIVVGPTLCAKQALPTT
AGPSNTSVVLTLHKLPNRTSGFLETDSRVAARTTGFGLLKRLQGFRAKIPGRLNQTSRYL
DQIPGHVNRTHGPLTGTHGLFPGPSPRALGALPGTSDMSSLPPDLWPGYSPSPTHPPTGQ
YTLFSPSPTSPTPPIQLHPLLPDPSVTPNSASPLLIAPHPHFQNLSQEE
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggagctgactgaactgctcctcgtggtcatgcttctcctaaccgcaagactgaatcta
tgccttccagctcctccagcctgtgacccccgtctcctaaataaactgcttcgtgattcc
catgtccttcacagcaaattgagccagtgcccagacgttaaccctttgtccacacctgtc
ctgctgcctgctgtggactttagcctgggagaatggaaaacccagaaggagcagaccaag
gcacaggacgttctgggagccgcgacccttctgctggagggagtaatggcagcacgggga
caactgggacctacctgcctctcatccctcctgggacagctttctggacaggtccgcctc
ctccttggggccctgcagggcctcctaggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatattcctgagcttccaacaactgctccgaggaaaggtg
cgcttcctgctgattgtagtagggcccactctctgtgccaagcaggccctgcccactaca
gctggcccaagcaatacctctgtagtcctcacactacacaagctcccaaacaggacttct
ggatttttggagacagactcccgtgtcgcagccagaactactggctttggacttctgaag
aggctgcagggattcagagccaagattcctggtcggctgaaccaaacctccaggtaccta
gaccaaatccctggacacgtgaacaggacacacggacccttgactggaactcatggactc
tttcctggaccctcacccagggccctaggagcccttccaggaacttcagacatgagctcc
ctgccacccgacctctggcctggatattctccttccccaacccatcctcctactgggcaa
tacacactcttctctccttcacccacctcacccactcccccgatccagctccaccccctg
cttcctgacccctctgtcacacccaactctgccagtcctcttctaattgcaccccaccct
cacttccagaatctgtctcaggaggagtaa

DBGET integrated database retrieval system