KEGG   Felis catus (domestic cat): 100302540
Entry
100302540         CDS       T02385                                 
Name
(RefSeq) chemokine (C-C motif) ligand 3-like precursor
  KO
K05408  C-C motif chemokine 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302540
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302540
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100302540
   04062 Chemokine signaling pathway
    100302540
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100302540
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100302540
  09163 Immune disease
   05323 Rheumatoid arthritis
    100302540
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100302540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100302540
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    100302540
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100302540
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   100302540
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100302540
NCBI-ProteinID: NP_001157129
Ensembl: ENSFCAG00000010007
UniProt: C5NM73
LinkDB
Position
E1:complement(23406673..23408070)
AA seq 93 aa
MKVPGAALAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK
PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtccccggggctgccctcgccatcctcctctgcaccatggctctctgcagtcag
gtcttctctgcaccatttggtgctgacaccccaactgcctgctgcttctcctatgtctcc
aagcagattccacgcaagttcatagctgactattttgagaccagcagccaatgctccaag
ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc
tgggtccaggaatatgtgactgacttggagctgagtgcctga

KEGG   Felis catus (domestic cat): 100302541
Entry
100302541         CDS       T02385                                 
Name
(RefSeq) chemokine (C-C motif) ligand 4-like precursor
  KO
K12964  C-C motif chemokine 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100302541
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302541
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302541
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100302541
   04623 Cytosolic DNA-sensing pathway
    100302541
   04062 Chemokine signaling pathway
    100302541
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100302541
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100302541
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100302541
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100302541
NCBI-ProteinID: NP_001157130
Ensembl: ENSFCAG00000010008
UniProt: C5NM74
LinkDB
Position
E1:23417954..23419289
AA seq 92 aa
MKLCVTVLSLLVLVAAFCSPTLSAPMGSDPPTACCFSYALRKLPRNFVVDYFETSSLCSQ
PAVVFQTKRGRQVCANPSDSWVQEYMDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaactctgtgtgactgtcctttctctccttgtgctagtggctgccttctgctccccg
acgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacgccctg
cggaagctccctcgaaactttgtagtggattactttgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaaggggcagacaagtctgtgctaaccccagtgactcc
tgggtccaggaatacatggatgacctggaactgaactga

KEGG   Felis catus (domestic cat): 101081091
Entry
101081091         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 3-like
  KO
K05408  C-C motif chemokine 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081091
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081091
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101081091
   04062 Chemokine signaling pathway
    101081091
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101081091
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101081091
  09163 Immune disease
   05323 Rheumatoid arthritis
    101081091
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101081091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101081091
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101081091
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101081091
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101081091
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101081091
NCBI-ProteinID: XP_003996626
Ensembl: ENSFCAG00000010006
UniProt: A0A2I2V3G2
LinkDB
Position
E1:23388772..23390682
AA seq 93 aa
MEVPKAALAVLLLTATLCSQTCSSFFGADTPTSCCFVYISRQIPRKFVVDYYETSSQCSK
PGVIFQTKRGREICADPREAWVQEYITNLELNA
NT seq 282 nt   +upstreamnt  +downstreamnt
atggaggtccccaaggctgccctggctgtcctgcttctcaccgcgacactctgttcccag
acctgctcttccttttttggtgccgacacccccacctcctgctgcttcgtctatatctcc
cggcagattccacgcaaatttgtggtcgactattatgagaccagcagccaatgctccaag
cccggtgtcatcttccaaaccaaaagaggccgggagatctgtgctgaccccagggaggcc
tgggtccaggaatacatcaccaacctggagctgaatgcctga

KEGG   Felis catus (domestic cat): 101097189
Entry
101097189         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 8
  KO
K16596  C-C motif chemokine 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101097189
   04061 Viral protein interaction with cytokine and cytokine receptor
    101097189
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101097189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101097189
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101097189
SSDB
Motif
Pfam: IL8 DUF3852 EF-hand_9
Other DBs
NCBI-GeneID: 101097189
NCBI-ProteinID: XP_003996607
Ensembl: ENSFCAG00000013594
UniProt: M3WJ48
LinkDB
Position
E1:22134162..22136163
AA seq 99 aa
MKVSAVLLCLLLTVATFSIQVLAQPGSVSIPITCCFSVVKGKIPMQKLESYTRITNIQCP
QEAVIFKTKTSREICADPKQKWVQDFMKRLDQKSQTQKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagtgcttctgtgcctgctgctcacagtggccaccttcagcatccag
gtgcttgctcagccaggttcagtttccatcccaattacctgctgcttcagtgtggtcaaa
gggaagatccctatgcagaagctagagagctacacaaggatcaccaacatccagtgtccc
caggaagctgtgatcttcaagaccaaaacatccagagagatctgtgctgaccccaagcaa
aagtgggtccaggatttcatgaagcgcctggaccaaaagtcccaaacccagaaaccttga

KEGG   Felis catus (domestic cat): 493689
Entry
493689            CDS       T02385                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine 5 precursor
  KO
K12499  C-C motif chemokine 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04668  TNF signaling pathway
fca05020  Prion disease
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    493689 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493689 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493689 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493689 (CCL5)
   04621 NOD-like receptor signaling pathway
    493689 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    493689 (CCL5)
   04062 Chemokine signaling pathway
    493689 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    493689 (CCL5)
   05168 Herpes simplex virus 1 infection
    493689 (CCL5)
   05163 Human cytomegalovirus infection
    493689 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493689 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    493689 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    493689 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493689 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493689 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    493689 (CCL5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   493689 (CCL5)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   493689 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 493689
NCBI-ProteinID: NP_001009827
Ensembl: ENSFCAG00000001259
UniProt: Q8SQ40
LinkDB
Position
E1:complement(23276060..23282999)
AA seq 92 aa
MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP
AVVFVTRRKRQVCANPQKKWVRDKGINSLEMN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaggtctccacagctgcctttgcagtcctcctcactgctgccgctttctgcactcct
gcctctgcatccccatatgcctcggacaccaccccctgctgctttgcctacctctcccac
ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca
gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg
gtgcgggacaagggcatcaactctttggagatgaactag

DBGET integrated database retrieval system