KEGG   Felis catus (domestic cat): 100302540
Entry
100302540         CDS       T02385                                 
Name
(RefSeq) chemokine (C-C motif) ligand 3-like precursor
  KO
K05408  C-C motif chemokine 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302540
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302540
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100302540
   04062 Chemokine signaling pathway
    100302540
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100302540
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100302540
  09163 Immune disease
   05323 Rheumatoid arthritis
    100302540
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100302540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100302540
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    100302540
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100302540
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   100302540
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100302540
NCBI-ProteinID: NP_001157129
Ensembl: ENSFCAG00000010007
UniProt: C5NM73
LinkDB
Position
E1:complement(23406673..23408070)
AA seq 93 aa
MKVPGAALAILLCTMALCSQVFSAPFGADTPTACCFSYVSKQIPRKFIADYFETSSQCSK
PGVIFQTRRGRQVCADPSEAWVQEYVTDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtccccggggctgccctcgccatcctcctctgcaccatggctctctgcagtcag
gtcttctctgcaccatttggtgctgacaccccaactgcctgctgcttctcctatgtctcc
aagcagattccacgcaagttcatagctgactattttgagaccagcagccaatgctccaag
ccaggggttatctttcaaaccagaagaggccggcaggtctgtgctgaccccagtgaagcc
tgggtccaggaatatgtgactgacttggagctgagtgcctga

KEGG   Felis catus (domestic cat): 101081091
Entry
101081091         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 3-like
  KO
K05408  C-C motif chemokine 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca05142  Chagas disease
fca05163  Human cytomegalovirus infection
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081091
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081091
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101081091
   04062 Chemokine signaling pathway
    101081091
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101081091
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101081091
  09163 Immune disease
   05323 Rheumatoid arthritis
    101081091
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101081091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101081091
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101081091
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101081091
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101081091
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101081091
NCBI-ProteinID: XP_003996626
Ensembl: ENSFCAG00000010006
UniProt: A0A2I2V3G2
LinkDB
Position
E1:23388772..23390682
AA seq 93 aa
MEVPKAALAVLLLTATLCSQTCSSFFGADTPTSCCFVYISRQIPRKFVVDYYETSSQCSK
PGVIFQTKRGREICADPREAWVQEYITNLELNA
NT seq 282 nt   +upstreamnt  +downstreamnt
atggaggtccccaaggctgccctggctgtcctgcttctcaccgcgacactctgttcccag
acctgctcttccttttttggtgccgacacccccacctcctgctgcttcgtctatatctcc
cggcagattccacgcaaatttgtggtcgactattatgagaccagcagccaatgctccaag
cccggtgtcatcttccaaaccaaaagaggccgggagatctgtgctgaccccagggaggcc
tgggtccaggaatacatcaccaacctggagctgaatgcctga

DBGET integrated database retrieval system