KEGG   Felis catus (domestic cat): 100510799
Entry
100510799         CDS       T02385                                 
Symbol
EGFR
Name
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04540  Gap junction
fca04630  JAK-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100510799 (EGFR)
   04012 ErbB signaling pathway
    100510799 (EGFR)
   04014 Ras signaling pathway
    100510799 (EGFR)
   04015 Rap1 signaling pathway
    100510799 (EGFR)
   04630 JAK-STAT signaling pathway
    100510799 (EGFR)
   04066 HIF-1 signaling pathway
    100510799 (EGFR)
   04068 FoxO signaling pathway
    100510799 (EGFR)
   04020 Calcium signaling pathway
    100510799 (EGFR)
   04072 Phospholipase D signaling pathway
    100510799 (EGFR)
   04151 PI3K-Akt signaling pathway
    100510799 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100510799 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100510799 (EGFR)
   04520 Adherens junction
    100510799 (EGFR)
   04540 Gap junction
    100510799 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100510799 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100510799 (EGFR)
   04915 Estrogen signaling pathway
    100510799 (EGFR)
   04921 Oxytocin signaling pathway
    100510799 (EGFR)
   04926 Relaxin signaling pathway
    100510799 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100510799 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100510799 (EGFR)
   05206 MicroRNAs in cancer
    100510799 (EGFR)
   05205 Proteoglycans in cancer
    100510799 (EGFR)
   05207 Chemical carcinogenesis - receptor activation
    100510799 (EGFR)
   05208 Chemical carcinogenesis - reactive oxygen species
    100510799 (EGFR)
   05230 Central carbon metabolism in cancer
    100510799 (EGFR)
   05231 Choline metabolism in cancer
    100510799 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100510799 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100510799 (EGFR)
   05212 Pancreatic cancer
    100510799 (EGFR)
   05225 Hepatocellular carcinoma
    100510799 (EGFR)
   05226 Gastric cancer
    100510799 (EGFR)
   05214 Glioma
    100510799 (EGFR)
   05218 Melanoma
    100510799 (EGFR)
   05219 Bladder cancer
    100510799 (EGFR)
   05215 Prostate cancer
    100510799 (EGFR)
   05213 Endometrial cancer
    100510799 (EGFR)
   05224 Breast cancer
    100510799 (EGFR)
   05223 Non-small cell lung cancer
    100510799 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100510799 (EGFR)
   05171 Coronavirus disease - COVID-19
    100510799 (EGFR)
   05163 Human cytomegalovirus infection
    100510799 (EGFR)
   05165 Human papillomavirus infection
    100510799 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100510799 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100510799 (EGFR)
   01522 Endocrine resistance
    100510799 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100510799 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100510799 (EGFR)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100510799 (EGFR)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100510799 (EGFR)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100510799 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100510799 (EGFR)
  Exosomal proteins of bladder cancer cells
   100510799 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1 Kdo Borrelia_P83
Other DBs
NCBI-GeneID: 100510799
NCBI-ProteinID: XP_006929148
Ensembl: ENSFCAG00000015468
LinkDB
Position
A2:70930530..71143327
AA seq 1207 aa
MRPSGTAGAALLLLLAAHFQASPALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALS
VLSNYGTNKTGLRELPMRNLHEILQGAVRFSNNPVLCNVETIQWRDIVDNDFISNMSMDF
QNHVGNCQKCDPGCPNGSCWGPGKENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIVSGNQKLCYANTINWKKL
FGTSSQKTKIINNKDEKGCKAIGHVCHPLCSSEGCWGPEPKDCVSCQNVTRGKECVEKCN
VLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDSCVQCAHYIDGPHCVKTCPAGIM
GENNTLVWKFADANRMCHLCHSNCTYGCSGPGLEGCATDGPKIPSIATGIVGGLLLVVVV
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLLSSLSATSNNSTVTCIDRNGSCPLKEDSFLQRYSSDPTGTLTEDNM
DDTFLPAPEYINQAVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVDNPEYLNTH
PTCVNSVLDGPTLWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENADYLRVAPP
SSEFIGA
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggaccgcgggagccgcgctcctgctgctgctggctgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggcacaagtaaccggctcacccag
ttgggcacttttgaggaccactttctcagcctgcagaggatgtttaataactgtgaggtg
gtccttgggaatttggaaatcacctacatgcaaaggaattatgacctttccttcttaaaa
accatccaagaggttgccggctatgtactcattgccctcaacacagtggagaagattccc
ttggaaaacctgcagatcatccgaggaaatgtgctctatgaaaacacccatgccttatct
gtcttatccaactatggcacaaataaaaccggactgcgggagctgcccatgagaaactta
catgaaatcctgcaaggcgctgtgcggttcagcaacaaccctgtcctctgcaacgtggaa
accatccagtggcgggatatcgttgacaatgatttcataagcaacatgtcgatggacttc
cagaaccacgtgggcaactgccaaaagtgtgatccaggatgtcccaatggaagctgctgg
ggtccgggaaaggagaattgccagaaattgaccaaaatcatctgcgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccataaccagtgtgctgccggctgc
acggggccccgagagagcgactgcctggtctgccgcaagttccgggatgaagccacgtgc
aaggacacctgcccgccactcatgctctacaaccccaccacctaccagatggacgtcaac
ccagagggaaaatacagctttggtgccacctgtgtgaagaaatgcccccgtaactacgtg
gtgacagaccacggttcgtgtgtccgtgcctgcagttctgacagctacgaagtggaggaa
gatggcgtccgcaagtgtaaaaagtgtgaggggccttgccgtaaagtttgtaatggaata
ggaattggtgaatttaaagacacactttccatcaatgctacaaatattaaacacttcaaa
aattgcacctcgatcagtggagatcttcatatcctgccagtagcatttagaggtgactcc
ttcacgcatactccacctctagatccaaaggaactggatattctaaaaactgtaaaggaa
attacagggtttttgctgattcaggcctggcctgaaaacaggactgacctccatgctttc
gagaacctagaaatcatacgtggaagaacaaagcaacatggtcagttttctcttgcggtt
gtgggcctggacataacgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcgtttcaggaaaccaaaaattgtgctatgcaaatacaataaactggaaaaaactg
tttgggacttcaagtcagaaaaccaaaattataaacaacaaagatgaaaaaggctgcaag
gccataggccatgtctgtcatccgttatgctcatcagagggatgctggggcccggagccg
aaagactgcgtgtcctgccaaaacgtcacccgtggcaaggaatgtgtggagaagtgcaat
gttctggagggggagccaagggagtttgtggagaattctgagtgcatacagtgccatcca
gaatgcctgccccaggccatgaatatcacctgcacaggacgaggaccagacagctgcgtg
cagtgtgcacactacatcgacggccctcactgcgtcaagacctgcccggctggcatcatg
ggagaaaacaacaccctggtctggaagtttgcggacgccaatcgcatgtgtcacctgtgc
cattcaaactgtacctacggctgttctgggccaggtcttgaaggctgtgctacagatggg
cccaagatcccatccatcgccactgggattgttgggggcctcctcttggtggtggtggtg
gcccttggggtgggcctctttctgcgccgacgccacatcgtccgcaagcgcacacttcgc
agactgctgcaggaaagagagcttgttgagcctcttacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggaaacagaattcaaaaagatcaaggtgctgggctct
ggagcatttggcacagtgtacaagggactctggatcccagaaggtgagaaggttaaaatt
cctgtggccatcaaggagttacgagaagccacatctccaaaagccaacaaggaaatcctt
gatgaagcttacgtgatggccagtgtggacaatccccacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtccagctcatcacacagctcatgcccttcggctgcctcctggac
tatgtccgcgagcacaaggacaacattggctcccagtacctgctcaactggtgtgtgcag
attgcgaagggcatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagcc
aggaatgtcctggtgaagacgccacagcatgtcaagatcacagattttgggctggccaaa
ctgcttggtgccgaggagaaagaataccacgcggaaggaggcaaagtgcctatcaagtgg
atggctttggaatcaattttacaccgaatttacacccaccaaagtgacgtctggagctat
ggagtcaccgtttgggagttgatgacctttgggtctaaaccttacgacggaatccccgca
agtgagatctcgaccatcctggagaaaggagagcgcctcccgcagccacccatatgcacc
atcgatgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccgaaa
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggagatgagagaatgcatctgccaagccctacagactccaatttttaccgcgcc
ctgatggacgaagaagacatggaagacgtcgtagatgccgatgagtacctcatcccccag
caaggcttcttccacagcccctccacatcccggacccccctcctgagttctctgagtgcc
accagcaacaattccaccgtgacttgcatcgatagaaatgggagctgccccctcaaggaa
gacagcttcttgcagcggtacagctcagaccccactggcaccttgactgaggacaacatg
gatgacactttcctcccggcacctgaatacataaaccaggctgttcccaaaaggcctgcg
ggttccgtccagaaccccgtctatcacaatcagcctctaaatccagctcctggcagagac
cctcactaccaaaatccccacagcaatgcagtggacaaccctgagtatctcaacacccac
cccacttgcgtcaacagtgtgctcgacggccccaccctctgggcccagaaaggcaaccac
cagattagcctggacaaccctgactaccagcaggacttctttcccaaggaagccaagtca
aatggcatctttaagggtcctgcagctgaaaatgcagactacctaagggtagcaccgccc
agcagtgaatttattggagcatga

KEGG   Felis catus (domestic cat): 101081159
Entry
101081159         CDS       T02385                                 
Symbol
IL20RB
Name
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101081159 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081159 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081159 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101081159 (IL20RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101081159 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 101081159
NCBI-ProteinID: XP_006936443
Ensembl: ENSFCAG00000001804
UniProt: M3VXB1
LinkDB
Position
C2:complement(128431121..128465327)
AA seq 294 aa
MWFFYTLIPCLLIDGVAILPAPQNLSVQSTNMKHLLMWSPVTVPGEIIYYFVEYQGEYES
LYMSHVWIPSSWCSPTKGPECDITDDITATVPYNLRVRATQGSETSAWSTLKPPFNRNST
ILTPPGMDVTKDGFHLVIKLEDLGSQFEFLVAYWRREPGAKEHVKVVRSRGIPVHLETME
PGAAYCVKVQTFVKAIGRHSPFSQTECVKVQGETLPLALALFGFVGFMLILVVVPLSIWK
MGRLLRHSCCPVVVLPDTLKITNSPQKLISCRREEVEACATAMLSSEEPFRTWI
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtggtttttctacaccttgattccatgtttgctcattgatggagtggccatcctgcct
gcccctcagaacctctctgtacaatcaaccaacatgaagcatctcttgatgtggagccca
gtgacggtgcctggagaaataatatactatttcgtcgagtaccagggagagtacgagagc
ctgtacatgagccacgtctggatccccagcagctggtgctcacccaccaaaggtcctgag
tgtgacatcactgatgacatcactgccactgtgccatacaatctccgtgtcagggccacc
cagggctcagagacctcagcctggagcactctgaagcctcccttcaatcgaaattcaacc
atccttaccccgcctgggatggatgtcaccaaggacggcttccatctggttattaagctg
gaagacctggggtcccagtttgagttccttgtggcttactggaggagggagcctggtgcc
aaggaacatgtcaaagtggtgaggagcaggggcattccggtgcacctggaaaccatggaa
ccaggggctgcatactgtgtgaaggtccagacattcgtgaaggccatcgggagacacagc
cctttcagccagacagaatgtgtcaaggtgcaaggagagaccctccccctggcgctggcc
ctgtttgggtttgttggcttcatgctgatcctcgtggttgtgcccctttccatctggaaa
atgggccggctgctccggcactcctgttgtcccgtggtggtgcttcccgacaccttgaaa
ataaccaattcaccccagaagttaatcagctgcaggagggaagaggtggaagcctgtgcc
actgctatgctgtcttcggaggaacccttcaggacctggatctag

KEGG   Felis catus (domestic cat): 101081364
Entry
101081364         CDS       T02385                                 
Symbol
EPOR
Name
(RefSeq) LOW QUALITY PROTEIN: erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101081364 (EPOR)
   04151 PI3K-Akt signaling pathway
    101081364 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081364 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101081364 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081364 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101081364 (EPOR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101081364 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 101081364
NCBI-ProteinID: XP_023101346
Ensembl: ENSFCAG00000004913
LinkDB
Position
A2:complement(8617362..8623373)
AA seq 508 aa
MDHLWAPLWPGVGSLCLLLAGAAWAPPPNPLDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPDNYSFFYQLEGEPWKPCSLHQAPTARGAVRFWCSLPTADASSFVPL
ELRVTAVSSGAPRYHRIIHINEVVLLDPPAGLLARRADEGGHVVLRWLPPPGAPVASLIR
YEVNISSGNVAGGAQKVEILDGRTECALSNLRGRTRYTFMVRARMAEPSFGGFWSAWSEP
ASLLTASDLDPLILTLSLILVLILLLLAVLALLSHRRTLKQKIWPGIPSPESEFEGLFTT
HKGNFQLWLYQNEGCLWWSPCAPFAEDPPSPLEVLSERCWGATQAAEPGAEEGPLLEPLG
SEHTQDTYLVLDKWLLPRNPPSEDLPRPDGSLDMVAMHKGSEASSCSSALSLKPGPEGAL
GASFEYTILDPSSQLLRPRALPPELPPTPPHIKYLYLMVSDSGISTDYSSGGSQEAQGDS
STGPYLNPYENSLIPATETSPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggatcacctctgggcgcccctctggcctggagtcggctctctctgtctcttgctcgct
ggggccgcctgggctcccccacccaaccccctggaccccaagttcgaaagtaaagcggcc
ctgctggctgcccgcggccccgaagagcttctgtgcttcaccgaacggttggaggacctg
gtgtgcttctgggaggaagcggcaagcgcgggggtcggccccgacaactacagcttcttc
taccagctcgagggcgaaccgtggaagccatgcagcctgcaccaggcgcccacggctcgc
ggcgctgtgcgtttctggtgctcgctgcctacggccgacgcgtcgagctttgtgccctta
gagctgcgcgtcacagccgtatcctcgggcgctccacgctatcaccgtatcatccacatc
aacgaagtggtgctcctggacccccccgcggggctgctggcgcggcgggccgacgagggc
ggccacgtggtactgcgttggctcccgcctcctggagcccccgtcgcaagtctgatccgc
tacgaagtgaacatctcctcaggcaacgtcgcagggggcgctcagaaggtggagatcctg
gatggccgcactgagtgcgcactgagcaaccttcgcggccgaacgcgctacacttttatg
gttcgcgcgcgtatggctgagccgagcttcggtggcttctggagcgcctggtccgagcct
gcgtcgctgctgacagctagtgacttggaccctctcatcctgacgctctcactcatcctc
gtgctcatcctgctgctgctggccgtgctcgccctgctttcccaccgccggactctgaag
cagaagatctggcctggtatcccaagccccgagagtgagtttgagggcctcttcaccacc
cacaagggtaacttccagctgtggctgtaccagaatgaggggtgtctttggtggagcccc
tgcgctccctttgcagaggacccaccctcccccctggaagtcctctctgagcgttgctgg
ggggctacccaggcagcggagccgggggcagaggaggggcccctgctggagccgctgggc
agcgaacatacccaagacacctacctggtgctggacaagtggttgctgccccggaaccca
cccagcgaggatctcccgcggcctgatggcagtttggacatggtagccatgcataaaggc
tcagaagcctcctcctgctcatctgccttgtccctgaagcctgggccagagggggccttg
ggtgccagctttgagtacacgatcctggatcccagctcccagctcttgcgcccaagagcg
ctgccccctgagctgccccccaccccaccccacataaagtacctgtacctcatggtgtct
gactctggcatctcaacggactacagctcagggggctcccaggaagcccagggggactca
tccactggcccctacttgaacccttatgagaacagcctcatcccagccactgagacttca
ccgcccagctatgtggcctgctcctag

KEGG   Felis catus (domestic cat): 101082243
Entry
101082243         CDS       T02385                                 
Symbol
IL15RA
Name
(RefSeq) interleukin-15 receptor subunit alpha isoform X1
  KO
K05074  interleukin 15 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04672  Intestinal immune network for IgA production
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101082243 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101082243 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101082243 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082243 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082243 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101082243 (IL15RA)
   04090 CD molecules [BR:fca04090]
    101082243 (IL15RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101082243 (IL15RA)
CD molecules [BR:fca04090]
 Proteins
  101082243 (IL15RA)
SSDB
Motif
Pfam: Sushi SKG6 NVEALA
Other DBs
NCBI-GeneID: 101082243
NCBI-ProteinID: XP_023112075
LinkDB
Position
B4:complement(5334927..5397331)
AA seq 287 aa
MGRRPPQGCGLRALPAPLPLPLLLLLLLRPPATPGVTCPPPTSVEHADIRVKSYKLNSTE
RYTCNTGFKRKAGTSTLTECVLNKTTNTAHWTIPNLKCIRDPSLTHLKPSSTEMPAGVTP
EPESTSLSGKEPAFTSKSDSTVATKAATEPGSRLIPSKPPAAGTTGVINNEPSRAPAQTT
AKALEHTPSATQEMPGTYSYSSGTVTAAIVMPVAVLCVVCVGLLVCYKRSRQTSQIRTVA
MENMEEIPMTGGTNGRDEDAENQAHNLGNSRGELRAAKAEARMPTLP
NT seq 864 nt   +upstreamnt  +downstreamnt
atgggccggcggccgccccagggctgcgggctccgcgccctccccgcgccgctgccgctg
ccgctgctgctgctgctgctgctccggccgccggcgacgcccggtgtcacgtgccctcct
cccacatctgtggaacatgcagacatccgggtcaagagttacaaactgaactccaccgag
cggtatacctgtaacactggcttcaagcggaaagccgggacgtccaccctgacagagtgc
gtgcttaacaagaccacgaacactgcccactggacaattcccaatctcaagtgcatcaga
gacccctccctgactcatctaaagccatcctctacagaaatgccggcaggggtgacccca
gagccagagagcacctccctttctggaaaagagccagctttcacttccaagtcagacagc
acagtggccacaaaggcagctactgagccaggctccaggctgataccatcaaagcctccg
gctgcgggaaccacaggggtaatcaataatgaaccctcccgagccccagctcagacaaca
gcaaaggccttggaacacaccccctctgccacgcaggagatgccaggtacctactcatac
agttccggaactgtgactgcggccatcgtcatgcctgtcgctgtgctctgtgtagtatgt
gtgggacttctggtgtgttacaaaagatccaggcaaacttcgcagatacgcactgttgca
atggagaacatggaagagataccaatgactgggggaaccaacggcagagacgaggatgca
gaaaaccaagcacacaacctaggaaactccaggggggagctgagggcagccaaggctgaa
gcaaggatgccaactcttccctag

KEGG   Felis catus (domestic cat): 101083429
Entry
101083429         CDS       T02385                                 
Symbol
IL22RA2
Name
(RefSeq) interleukin-22 receptor subunit alpha-2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101083429 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101083429 (IL22RA2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101083429 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101083429
NCBI-ProteinID: XP_003986643
Ensembl: ENSFCAG00000021984
LinkDB
Position
B2:complement(126512613..126536727)
AA seq 282 aa
MYLKNEIVVPSRNRLNPRGDVRHEDSTVSSSVQSCALTEGSTGCLTGHIATMTPKHCFLG
FLISFLLTGVVETQSAHESLMPQRVHFQSRNFHNILHWQPGRACTSNSSIYFVQYKMYGQ
RQWKNKEDCWGILESFCDLTNETSDIQEPYYGRVRTISAGIRSGWTMTQRFTPWWETKID
PPVMNITQVNGSLLVILHAPGLPYRDQKGKNVSIENFYELVYRVFIINNSIGKEQKVYEG
AHRVVEIGVLAPHTAYCVVAEMYQPMLDKRSRRSEEKCVELP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtatttaaagaatgaaattgtagttccttcaaggaaccgcttaaacccacgaggggat
gtccggcatgaggattctacagtttcctcttctgtccagagctgtgctctcactgagggc
agcactggttgtctgaccggtcacattgcaaccatgacgcctaaacattgctttctaggc
ttcctcatcagtttcctcctgactggtgtagtggaaacccagtcagcccatgaatccctg
atgcctcagcgagtacattttcagtctcgaaatttccacaacattttgcactggcagcct
gggagggcttgtaccagcaacagcagtatctatttcgtacagtataaaatgtatggacag
agacaatggaaaaataaagaggactgttggggtattctcgaatccttttgtgaccttacc
aatgaaacatcagatatacaggaaccttactatggaagggtgaggaccatctcagctggg
atccgctcaggctggaccatgacgcagcgcttcactccctggtgggaaacgaaaattgat
cctccagtcatgaatataactcaagttaatggatctttgttggtgattcttcatgctcca
ggtttaccatatagagaccaaaaaggaaaaaatgtatcaatagaaaatttctatgagcta
gtatatcgagtctttataattaacaattcaataggaaaggaacaaaaggtatatgaagga
gctcacagagttgttgaaattggagttctggcacctcacactgcttactgtgtagtggct
gaaatgtaccagcccatgctagacaaaagaagtcggagaagtgaagagaaatgtgtggaa
cttccttga

KEGG   Felis catus (domestic cat): 101083719
Entry
101083719         CDS       T02385                                 
Symbol
CNTFR
Name
(RefSeq) ciliary neurotrophic factor receptor subunit alpha isoform X1
  KO
K05059  ciliary neurotrophic factor receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101083719 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101083719 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101083719 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101083719 (CNTFR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101083719 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Receptors
  101083719 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 Ig_5
Other DBs
NCBI-GeneID: 101083719
NCBI-ProteinID: XP_023098166
Ensembl: ENSFCAG00000027805
LinkDB
Position
D4:complement(58368183..58407599)
AA seq 399 aa
MAAPVPWACCAVLAAATAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGTLTPFSIGVPVTLAL
AAAAATANSLLICPLPCLPRARHPVRTCQRTCRGAGGRS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgctgccgccactgctgttgtc
tacgcccagagacacagtcctcaggaggcaccccacgtgcagtacgagcgcctgggttca
gatgtgactctgccgtgtgggacagcaaactgggatgcagcggtcacgtggagggtaaat
gggacagacctagcccctgacctgctcaacggctctcagcttgtgctccatggcttggaa
ctgggccatagcggcctctatgcctgcttccaccgtgactcttggcatctgcgccaccaa
gtcctactacatgtcggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacatccccaacacc
ttcaatgtgaccgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacatccgctacatgcacctgttctccaccatcaagtacaaggtctcg
ataagtgtcagcaatgccctgggccacaacgccacagctatcaccttcgacgagttcacc
attgtgaaacctgaccctccagaaaatgtggtagcccgaccagttcccagcaaccctcgc
cggctagaggtgacttggcagaccccttcaacctggcctgaccctgagtcctttcctctc
aagttctttctgcgataccgacccctcatcctggaccagtggcagcatgtagagctgtca
gatggcacagcgcacaccatcacagatgcctatgctgggaaggagtacatcatccaggtg
gcggccaaggacaatgagattgggacatggagtgactggagtgtggccgcccatgccacg
ccctggactgaggagccacgacacctcaccactgaggcccaggctccggagaccacgacc
agcaccaccagctcactggcacccccacccaccacgaagatttgtgaccctggggagctg
ggcagcggcggaggaaccttgacacccttctcaatcggcgtccctgtgaccctggccctg
gccgctgctgccgccactgccaacagtctcctgatctgccccctgccctgtctccccaga
gcccggcatcccgtgaggacatgccagcgcacctgcagaggagcaggaggccggagctga

KEGG   Felis catus (domestic cat): 101084600
Entry
101084600         CDS       T02385                                 
Symbol
PDGFRB
Name
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  JAK-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101084600 (PDGFRB)
   04014 Ras signaling pathway
    101084600 (PDGFRB)
   04015 Rap1 signaling pathway
    101084600 (PDGFRB)
   04630 JAK-STAT signaling pathway
    101084600 (PDGFRB)
   04020 Calcium signaling pathway
    101084600 (PDGFRB)
   04072 Phospholipase D signaling pathway
    101084600 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    101084600 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101084600 (PDGFRB)
   04540 Gap junction
    101084600 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101084600 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084600 (PDGFRB)
   05206 MicroRNAs in cancer
    101084600 (PDGFRB)
   05230 Central carbon metabolism in cancer
    101084600 (PDGFRB)
   05231 Choline metabolism in cancer
    101084600 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    101084600 (PDGFRB)
   05218 Melanoma
    101084600 (PDGFRB)
   05215 Prostate cancer
    101084600 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084600 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101084600 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101084600 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101084600 (PDGFRB)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101084600 (PDGFRB)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101084600 (PDGFRB)
CD molecules [BR:fca04090]
 Proteins
  101084600 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Haspin_kinase
Other DBs
NCBI-GeneID: 101084600
NCBI-ProteinID: XP_011284405
Ensembl: ENSFCAG00000003634
LinkDB
Position
A1:199039211..199076869
AA seq 1096 aa
MPAPVLKGQVLLLPLLLLLGPQASWGLVITPPGPELVLNISSTFVLTCSGAAPVVWERMS
QKPLQKTAKNQDGTFSSTLTLTNVTGLDTGEYFCTYKNSLGPEPAERKRLYIFVPDPTMG
FLPVFPEDLFIFLTEISEITIPCRVTDPSLVVTLHEKKVDIPLPIPYDHQRGFSGIFEDK
TYVCKTIIGDREVDSEAYYVYSLQVSSINVSVNAVQTVVRQGENITIMCIVTGNEVVNFE
WTYPRMESGRLVEPVTDFLFNVPSHIRSILHIPNADLGDSGTYICNVSESVNDHRDEKSI
NVTVVESGYVQLLGELDAVQFAELHRSRTLQVVFEAYPPPTVMWLKDNRTLGDSSAGEIA
LSTRNVSETRYVSELTLVRVKVAEAGYYTMRAFHEDAEAQISFQLQVNVPVRVLELSENH
PASGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEDSQLETNVTYWPED
QEFEVVSTLRLRRVDQPLSVRCTLHNLLGHDMQEVTVVPHSLPFKVVVISAILALVVLTI
ISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTL
GSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVN
LLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCSDKRRPPSAELYSNALPAGLPL
PSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGGIKYADIESSSYVAPYDNYVPTAPERT
CRATLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFG
LARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPE
LPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGY
KKKYQQVDEEFLRSDHPAVLRSQARFPGFNGLRSPLDTSSVLYTAVQPNESDNDYIIPLP
DPKPEIADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLEPQVEPEPPL
DSCCPGPRAEAEDSFL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgccagctcctgtcctcaaaggccaggtgctgttgctgcccctgctgttgctgctggga
ccacaggcctcctggggcctggtcatcacaccaccggggccagagcttgtcctcaatatc
tccagcaccttcgttctgacctgttcgggtgcagctccggtggtgtgggaacggatgtcc
cagaagcccctgcagaaaacggccaagaaccaggatggcaccttctccagcacactgaca
ctgaccaatgtcactgggctagacacgggagaatacttttgcacctacaaaaactccctc
gggccggaacctgctgagcgaaaacggctctacatctttgtgccagatccgactatgggc
tttcttccggtcttccccgaggacctgttcatctttctcacggaaatatctgagatcaca
attccctgccgagtgacagatccgagcctggtggtgacactgcacgagaagaaagtggat
attccactgcccatcccctatgaccaccaacgtggcttctctggtatcttcgaggacaag
acctatgtctgcaaaaccatcatcggggacagggaagtggattctgaagcctactatgtc
tacagtctccaggtgtcgtccatcaatgtctcagtgaatgcagtgcagactgtggtccgc
cagggtgagaacatcaccatcatgtgcattgtgaccggaaatgaggtggtcaactttgaa
tggacatacccacgcatggagagtgggcggctggtggagccagtgactgacttcctcttc
aatgtaccctcccacatacgctccatcctgcacatccctaatgccgaccttggcgattca
gggacctacatctgcaatgtatcggagagtgtgaatgaccatcgagatgaaaagtccatc
aatgtcactgtggttgagagtggctacgtgcagctgctgggagagctggacgccgtacaa
ttcgcggagctgcaccgcagccggactctgcaggtggtgttcgaggcctacccgccgcct
actgtcatgtggctcaaggacaaccgcacgctaggcgactccagcgcaggcgagattgcc
ctgtccacacgcaatgtgtctgagacccggtatgtgtcagaactgacattggtgcgggtg
aaggtggctgaggctggctactacaccatgcgggccttccacgaggatgcagaggcccag
atctccttccagctgcaggtcaatgtgcctgtccgtgtgctggagctgagtgaaaaccat
cctgccagcggggagcagacagtccgctgtcgcggccggggcatgccccagccacacctc
acctggtctacctgcagtgacctcaaaagatgtccgcgcgagctgccgcccaccccactg
gggaacagttccgaggaggacagccagctggagactaacgtgacttactggcctgaggat
caggagttcgaggtggtgagcacgctgcgcctgcgccgtgtggatcagcctctgtccgtg
cgctgcactctgcacaacctgctgggccacgacatgcaggaggtcaccgtggtgccacat
tctctgcccttcaaggtggtggtgatctcggccatcctggccttggtggtcctcacaatc
atctccctcatcatcctcatcatgctctggcagaagaagccacgttatgagatccgatgg
aaggtgattgaatctgtgagctctgatggccatgagtacatctacgtggaccctatgcag
ctgccctatgactctacctgggagctgccacgggaccagcttgtgcttggacgcaccctc
ggctctggggcctttgggcaggtggtggaggccacagctcacggcctgagccattctcag
gccacgatgaaagtggcggtcaagatgctgaaatccacagcccgcagcagcgagaagcag
gccctcatgtcagagctgaagatcatgagtcaccttgggccccatctgaacgtggtcaac
ttgctgggggcctgcaccaaaggaggacccatctacatcatcacggagtactgccgctac
ggtgacctggtggactaccttcaccgcaacaagcacacctttctgcagcgctgctccgac
aagcgccgcccgcccagcgccgagctctacagcaacgccctgcccgcggggctccctctg
cccagccacgtgtccctgcctggggagagtgacggcggctacatggacatgagcaaggac
gagtcggtggactacgtgcccatgctggacatgaaaggaggaatcaaatatgcagacatc
gagtcctccagctacgtggccccttatgacaactacgtccctacagctcccgagaggacc
tgtcgggcaactctgatcaacgagtccccggtgcttagctacacagatcttgtgggcttc
agctaccaggtggccaacggcatggagttcctggcctccaagaactgcgtccaccgagat
ctggcggccaggaacgtgctcatctgtgagggcaagctggtcaagatctgtgactttggc
ctggctcgtgacatcatgagggactcgaactatatctccaaaggcagtaccttcctgcct
ctgaagtggatggctcccgagagcatcttcaacagcctctataccaccctgagtgatgtg
tggtccttcgggatcctactctgggagatcttcaccctgggtggcaccccttacccagag
ctgcccatgaacgagcagttctataatgccatcaagcggggttaccgaatggcccagcct
gcccatgcctccgatgagatctacgagatcatgcagaagtgctgggaagagaagtttgag
atccggcctcccttctcccagctggtgctgcttctcgagaggctgctgggtgaggggtac
aagaagaagtaccagcaggtggatgaggagtttctgaggagcgaccacccagccgtcctt
cggtcccaagcccgctttcccggcttcaatggactccgatcccccctggacaccagctct
gtgctctacactgctgtgcagcccaacgagagtgacaatgactatatcatccccctgcct
gaccccaaacccgagattgctgatgagggccccctggagggttcccccagccttgccagc
tccaccctgaatgaagtcaacacctcctctaccatctcctgcgacagccccctggaaccc
caagaggagccagagccagaaccccagctcgagccccaggtggagccagagccaccactg
gattcatgttgccctgggcctcgggccgaggcggaagacagcttcctgtag

KEGG   Felis catus (domestic cat): 101085646
Entry
101085646         CDS       T02385                                 
Symbol
LEPR
Name
(RefSeq) LOW QUALITY PROTEIN: leptin receptor
  KO
K05062  leptin receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04080  Neuroactive ligand-receptor interaction
fca04152  AMPK signaling pathway
fca04630  JAK-STAT signaling pathway
fca04920  Adipocytokine signaling pathway
fca04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085646 (LEPR)
   04152 AMPK signaling pathway
    101085646 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085646 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    101085646 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101085646 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085646 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085646 (LEPR)
   04090 CD molecules [BR:fca04090]
    101085646 (LEPR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101085646 (LEPR)
CD molecules [BR:fca04090]
 Proteins
  101085646 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 101085646
NCBI-ProteinID: XP_023114555
Ensembl: ENSFCAG00000011703
LinkDB
Position
C1:54485534..54576356
AA seq 1166 aa
MICQKFCVALLHCEFIYLITAFNLAYPITPWRFKLSCMPPNTTYDFLLPTGISKNTSNVN
EHYEAVVEAKFNSSSTYLSNLSSKTTFHCCLWSEEDKNCSVHADDVEGKAFVATVNSLVF
QQIGANWNIQCWTKEDLELFICYMESLFKNPFKAYDLKVHLLYVLPEVLEESLPVPQKGS
FLTVQCNCSVRDSCECHVPVPAAKLNHTLLMYFKITSGGVIFQSPMMSVQPINVVKPDPP
LGLHMEITDTGNLKISWSSPTLVPFQLQYQVKYSENSSTNMRKADEIVSATSLLVDSVLP
GSSYEVQVRGRRLDGPGLWSDWSAPLIFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKI
VSSKKIVWWMNLAEKIPQSQYHVVGDHVSKVTFRSLKATKPRGKFTYDAIYCCNEHECHH
RYAELYVIDVNINISCETDGYLTQMTCRWSTNAIQSLVGSTLQLRYHRSSLYCSDVPSIH
PISESKDCHLQRDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVVPDSVVKPLPP
SSVKVEITVKIGLLKISWEKPVFPENNLKFQIRYGLSGKEVQWKMYEVHDAKSNSASVLV
PDLCAVYAVQVRCKRLDGLGYWSNWSSPAYTVVTDIKVPTRGPEVWRIINEDTTKKERNV
TLLWKPLMKNDSLCSVRKYVVKHHTSRNGTWSEDVGNHTQFTFLWTEQAHSVTVLAVNSI
GASFVNFNLTFSWPMSKVNTVQSLSAYPLNSSCVFLSWKLSPSDYSLMYFITEWKILNED
SETKWLRIPSSVKKYYIHDHFIPIEKYQFSLYPVFMEGVGKPKIINSFTPDDIEKRQNDA
GLYVIVPIIISSSILLLGTLLISHQRMKKIFWEDVPNPKNCSWAQGLNFQKPETFEHLFV
KHTESVIFGPLLLEPEAISEDVSVDTTWKNKDDMMPTTLVSLLLATPDLEKGSICISDQH
NSADFSELESSVVTYEDENRRQPSVRYATLLSSSKSSDIDEEQGLINSSVSKCFSSKNSL
SKDSFSNSSWEIETQAFFILSDQHPNIISPHLPFSEGLDEFLKPEGNFPEENNGERSVYY
LGVTSIKKRESGVFLTDESQVLCPFPAHCLLTDIRILQNTCSQLVENHFSLGTNGQKTFV
SYMPQFQTCSTQTRKIMENTMCDLTV
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggctttgttacattgtgaatttatttatttgataact
gcatttaacttggcatacccaattactccctggagatttaagttgtcgtgcatgccacca
aatacaacctatgactttctcttgcctactggaatctccaagaacacttcaaatgtgaat
gaacattatgaggcagttgttgaagctaaatttaattcaagtagtacctacctttctaat
ttatcttccaaaacaacttttcactgttgcctttggagcgaggaagataaaaactgttct
gtacatgcagatgacgtggaagggaaggcatttgttgcaacagtgaattctttagttttc
caacaaataggtgcaaactggaacatacagtgctggacgaaagaggacttggaattattc
atctgctatatggagtcactatttaagaatcctttcaaggcttatgaccttaaggtccat
cttttatatgttctgcctgaagtgttagaagagtcacttccggtcccccaaaagggcagt
tttctgactgttcagtgtaactgcagtgttcgtgacagctgtgaatgccatgtgcctgtg
cccgcagccaaactcaaccacactcttcttatgtatttcaaaatcacgtctggtggagta
atttttcagtcacctatgatgtcagttcagcccataaatgttgtgaagcctgatccacca
ttaggtttacatatggaaatcacagacactggcaatttaaaaatttcttggtccagccca
acattggtaccatttcaacttcaatatcaagtgaaatattcagagaattcttcaacaaat
atgagaaaagctgatgagattgtctcagctacatctctgctggtagacagtgtgcttcct
gggtcttcatatgaagttcaagtgaggggcaggagactggatggcccaggactctggagt
gactggagcgcgcctctgatctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgtcgggtctaacgtttcttttcactgcatttataaaaatgaaaacaagatt
gtttcctcaaaaaagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatcatgtcgtgggtgaccatgttagcaaagttacttttcgcagtttgaaggcaaccaaa
cctcgagggaagtttacctacgatgcaatatactgctgcaatgagcatgaatgccaccat
cgctatgctgaattatatgtgattgatgtcaatatcaatatatcctgtgaaactgatggg
tacttaactcaaatgacttgcagatggtcaaccaatgcaatccaatcactcgtgggaagt
actttgcagttgaggtatcataggagcagcctttactgctctgatgttccatctattcat
cccatatctgaatctaaagattgccatttgcagagagatggtttttatgaatgcgtattt
cagccaatctttctattgtccggctatacaatgtggattagaatcaatcactctttgggt
tcacttgactctccaccaacgtgtgttgttcctgattctgtggtgaaaccactgcctcca
tccagtgtgaaagtggaaattactgtaaaaattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataatcttaaattccagattcgctacggcttaagtggaaaagaa
gtacagtggaagatgtatgaggtgcatgatgcaaaatccaattctgccagcgtcctggtg
ccagatctgtgtgctgtctatgctgttcaggtgcgctgcaagaggctggatgggctggga
tattggagcaattggagtagtccagcctacacagttgtcacagatataaaagttcctacc
agaggacctgaagtttggagaataattaatgaagacaccactaaaaaagagagaaatgtt
actttactttggaagcctctgatgaaaaatgactcattgtgtagtgtaagaaaatatgtg
gtaaaacatcatacttcccgcaatggaacatggtcagaagatgtgggaaatcacactcaa
ttcactttcctgtggacagagcaagcacattctgttacagttctggctgtcaattcaatt
ggtgcttcttttgtgaattttaatttaacattctcatggcctatgagcaaagtaaatacc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgtttctttcctggaaatta
tcacccagtgattactctctgatgtattttattactgagtggaaaattcttaatgaagac
agtgaaactaaatggcttagaatcccttcatccgttaagaagtattatattcatgatcat
tttatccccatcgagaagtatcaattcagtctttacccagtatttatggaaggagtgggg
aaaccgaagataattaatagttttaccccagatgatattgaaaaacgccagaatgatgca
ggtctatatgtaattgtgccaataattatttcctcttcaatcttattgcttggaacatta
ttaatatcacaccaaagaatgaaaaagatattttgggaagatgttccaaaccccaagaac
tgttcctgggcacaaggacttaattttcagaagccagaaacgtttgagcatctttttgtc
aagcatacagaatcagtgatatttggtcctcttcttttggagcctgaagccatttcagaa
gatgtcagtgttgacacaacatggaaaaataaagatgacatgatgccaacaactctggtc
tctctacttttggcaactccagatcttgaaaagggttctatttgtatcagtgaccagcac
aacagtgctgacttctctgagcttgagagcagcgtggtaacctatgaggatgaaaacagg
agacagccctctgttagatatgctaccctactcagcagctctaaatcaagtgacattgat
gaagagcaagggcttataaacagttcagtcagcaaatgcttctctagcaaaaattctctg
tccaaggattctttctctaacagctcatgggagatagaaacccaggcattttttatatta
tcagatcagcatcccaatataatttcaccacaccttccgttctcagaaggattggatgaa
tttttgaaacctgagggaaatttccctgaagaaaataatggtgagaggtctgtctattat
ttaggggtcacctcaatcaagaaaagagagagtggtgtgtttttgactgacgagtcacaa
gtgttgtgtccgttcccagcccattgtttactcactgacatcagaatcctccagaacact
tgctcacaacttgtagaaaatcatttcagtttaggaactaatggtcagaagacttttgta
tcttacatgcctcagtttcagacttgttctactcagactcggaagataatggaaaacaca
atgtgtgacctaactgtctaa

KEGG   Felis catus (domestic cat): 101085689
Entry
101085689         CDS       T02385                                 
Symbol
IL6R
Name
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04066  HIF-1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04659  Th17 cell differentiation
fca04932  Non-alcoholic fatty liver disease
fca05163  Human cytomegalovirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085689 (IL6R)
   04066 HIF-1 signaling pathway
    101085689 (IL6R)
   04151 PI3K-Akt signaling pathway
    101085689 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085689 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101085689 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101085689 (IL6R)
   04659 Th17 cell differentiation
    101085689 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085689 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101085689 (IL6R)
   05163 Human cytomegalovirus infection
    101085689 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085689 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101085689 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085689 (IL6R)
   04090 CD molecules [BR:fca04090]
    101085689 (IL6R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101085689 (IL6R)
CD molecules [BR:fca04090]
 Proteins
  101085689 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3 V-set I-set Ig_5
Other DBs
NCBI-GeneID: 101085689
NCBI-ProteinID: XP_023103841
Ensembl: ENSFCAG00000026747
LinkDB
Position
F1:complement(70919010..70964695)
AA seq 468 aa
MLALRCALLTALLAAPGAALTPGGCPAPEVLSDVVTARPGANVTLTCPGEEPGDSATIHW
LLRNRVPGSQQERGAGVGGRLLLRSVQLSDSGNYSCYRDDGSLAGTVPLLVEAPPEEPQI
TCFRKSPLSKVACEWGPRSPPSGTTRATLLVRKFGTSPMGDSEEPCQYFPGPQTFSCQLA
VPEGDNSLYVVSLCVSNAAGSKSSHPQTFEGYGILQPDPPVNVTVTAVPGNPRWLRVTWR
DPPSWNSYFYRLQFELRYRAERSKTFTTWMVKELQHHCIIHDAWRGTRHRVQVRAREEFG
HGSWSAWSPEAAGAPWTEPRSPPAKTEAPPSTQAPTTNGDDENNLLKDSANATSLPVQDS
SVPLPTFLVAGGSLAFGTLLCVGLVLRFRKTWKLQALKEGKASAQPPYALGQLVPERPQP
RPGLVPLLSPPVNPGSLGSDNTSGHGRPDARGPRSAYDVTNRDYFLPR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctggccctgcgctgcgcgctgctcaccgccctgctggccgcgccaggggccgccctg
acccccgggggctgtcccgcgccggaggtgctgagtgatgtggtgactgcccggcctggg
gccaacgtgaccctgacctgcccgggcgaggagcctggagacagtgccacgattcactgg
ctgctgaggaatcgggtcccaggctcacagcaggaacggggtgctggcgtgggagggagg
cttcttctgaggtcggtgcagctcagcgactctggaaactactcctgttaccgcgacgac
ggcagcctggctggaaccgtgcctttgctggtggaagcccctcccgaggagccccagatc
acctgcttccggaagagccccctcagcaaggtggcctgtgagtggggtcctcggagcccc
ccctccgggacgaccagggccacgcttctggtgaggaagttcgggaccagccccatggga
gactcggaggagccgtgccagtactttccggggccgcagaccttctcctgccagctggca
gtccctgagggggacaactccttgtacgtggtgtccctgtgcgtcagcaacgccgctggg
agcaagtccagccatccccaaacgtttgagggctacggaatcctgcagcctgacccgcct
gtcaatgtcaccgtcactgctgtgcccggaaacccccgctggctcagggtcacctggcgg
gaccccccgtcctggaactcctacttctacaggctgcagtttgagctccgataccgggcc
gagcggtcgaagacgttcacaacgtggatggtcaaggagctgcagcatcactgcatcatc
cacgacgcctggagaggcacgaggcacagggtgcaggtccgggcccgggaggagtttggg
cacggctcctggagcgcgtggagcccggaggccgcgggcgccccgtggacagaacccagg
agccccccagccaagacggaggcgcccccctccacgcaggcaccgactactaatggagac
gatgaaaataatctcttgaaagattctgcaaatgcaaccagcctcccagtgcaagactct
tcggtgccactgcccaccttcctagtggccggaggaagcctggccttcggaacgctcctg
tgcgttggcctcgtcctgaggttcaggaagacgtggaagctgcaggccctgaaggaaggc
aaggccagcgcacagccgccgtatgctctggggcagctggtccccgagaggccccagccc
aggccggggctcgtccccctcctctctcctcccgtgaaccccggcagcctcgggtctgac
aacacgtcggggcacggccggccggacgccaggggcccccggagcgcttacgacgtcact
aaccgagactacttcttacccagatag

KEGG   Felis catus (domestic cat): 101085930
Entry
101085930         CDS       T02385                                 
Symbol
IL11RA
Name
(RefSeq) interleukin-11 receptor subunit alpha isoform X5
  KO
K05056  interleukin 11 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101085930 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101085930 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101085930 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101085930 (IL11RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101085930 (IL11RA)
SSDB
Motif
Pfam: ig fn3 Ig_3 EpoR_lig-bind Ig_2
Other DBs
NCBI-GeneID: 101085930
NCBI-ProteinID: XP_003995632
Ensembl: ENSFCAG00000003158
UniProt: A0A2I2V0P2
LinkDB
Position
D4:58464742..58480846
AA seq 422 aa
MSSSCSGLSRVLVAAAIALVSTSSPCPQAWGPPGVQYGQPGRSMTLCCPGVTSGAPVSWF
RDGETRLLQGPDSGLGHELVLARADSTDEGTYICRTLDGALKGIVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCPQDPPGASRC
VVHGAEFWSQYRINVTEVNPLGVSTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSIGPLPKEIPAGGQPHKQLEEEPQADCPASPRPSLLPDPRPLDHR
DPLEQVAVLASLGIFSFLGLAAGALALGLWLRLRPDGKDGPQKPGFLAPVIPVDKLPGAP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgcggctatagccctggtg
tccacctcctccccctgcccccaggcctggggccccccaggggtccagtatgggcagcct
ggcaggtccatgacactgtgttgccctggagtgacttctggggccccggtgtcctggttt
cgggatggggagacaaggctgctccaaggacctgactctgggctagggcatgaactggtc
ttggcccgggcagacagcactgatgaaggcacctacatctgccggaccctggatggtgca
cttaagggcattgtgaccctacagctgggctaccccccagcccgccctgttgtctcctgc
caagcagctgactatgagaacttctcctgcacttggagccccagtcaggtcagcggttta
cccacccgctacctcacctcctacaggaagaagacagtaccaggagctgatggccagagg
atgagtccatccacagggccctggccatgcccacaggatcccccaggggcttcccgctgt
gtagtccatggggcagaattctggagccagtaccgaatcaatgtgactgaggtgaacccc
ctaggggtcagtacacgcctgctggatgtgagcttgcagagcatcttgcgccctgaccca
cctcaggggcttcgagtagagtcggtacctggctacccccgccgcctgcgtgccagctgg
acatacccggcctcctggccccgccagccccactttctgctcaagttccgactgcagtac
cgtccagcgcagcatccagcctggtccacggtggagccagctggattggaggaagtgatc
acggatgctgtggctgggctgccccatgctgtacgagtcagtgcccgggactttctggat
gctggcacctggagtgcctggagccctgaggcctgggggactccaagcattgggcccctg
ccaaaggagataccagctgggggccagccacacaagcagctggaggaggagcctcaggca
gactgccccgcttcccccaggccctccctcttgccagatccacggccacttgaccacagg
gaccccctggagcaggtagcggtgctggcatctttgggaatattctctttcctcggactg
gcggctggggccctggcactggggctctggctgagactgagaccagatggtaaggatgga
ccccaaaagcctgggttcttggctccagtgattccagtggacaaacttccaggagcccca
aacctgtag

KEGG   Felis catus (domestic cat): 101086565
Entry
101086565         CDS       T02385                                 
Symbol
IL20RA
Name
(RefSeq) interleukin-20 receptor subunit alpha isoform X1
  KO
K05136  interleukin 20 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101086565 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086565 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101086565 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101086565 (IL20RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101086565 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101086565
NCBI-ProteinID: XP_006932109
Ensembl: ENSFCAG00000029581
LinkDB
Position
B2:complement(126417447..126452851)
AA seq 503 aa
MRNILQWSPPEGLQEAELTYTVQYFIYGQKKWLNKSECRNINRTCCDLSVETSDYEHQYY
AKVKAIWETNCSKWAETGRFYPFLETQIGPPEVALSTDEKSISIVLTAPEKWKRNPEESS
ISMQQIYSNLKYNVSVYNAKSNRTWSQCVTNRTLVLSWLEPDTLYCVRVETFVPGPPRLA
QPSEKQCVRTQKDQTSALKVKIIFWYVLPISVAVFIFSVMGYSMYRYIHVGKEKHPANLI
LIYGNEFDKRFFVPAEKIVINFITLNILEDSKISHKDMRHVVEKSDDGSDGDEPGRDQRP
RQAEMEVKHLGYASHLVDISCDSGESTQGTSLTQQGSPGRAIPTEKAVVEYEYDVRAADV
CVGPGGPELNLQEKVSLQGTFFEQQAALADVSPQAPLYSYAPQLRHLDQLLQEHVGTEEE
REEEPSTTLVDWDPRTGRLCIPSFPSFEHGSEGDKQPESKELVEEGLLSRLYEEQAPDKP
SEDNETDLLKFMEEWGLYVQMED
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaggaatatcctacagtggagtccgccagagggtctacaagaagctgaacttacttac
actgtgcagtatttcatatatgggcaaaaaaaatggctgaataaatccgaatgtagaaat
atcaataggacctgctgtgatctctctgtggaaacttccgattatgaacatcaatattat
gccaaagttaaggccatttgggaaacgaattgttccaaatgggcagaaaccggacgattc
tatccattcttagagacacaaatcggcccaccagaagttgctttatctacagatgagaaa
tccatttctattgttctgacggctccagagaagtggaagagaaatccagaggaaagttct
atttccatgcaacagatttactctaacctgaagtacaacgtgtccgtatataatgctaag
tctaatagaacgtggtcccagtgtgtgaccaaccgcacgctggtgctcagctggctggag
ccagacaccctgtactgcgtgcgtgtggagacctttgtcccagggccccctcgccttgct
cagccttctgagaagcagtgtgtccgtactcagaaagatcaaacatcagcattgaaggtt
aaaatcatcttctggtatgttttgcccatatctgttgccgtgtttattttttctgtgatg
ggctactccatgtacagatatatccatgttggcaaagagaaacacccagcaaatttgatt
ttgatttatggaaatgaatttgacaaaagattctttgtacctgctgaaaaaattgtgatt
aattttatcaccctcaatattttggaggattctaaaatttctcataaggatatgagacac
gtagtggaaaaaagcgacgacgggtcggatggggatgagcccggcagggaccagcggccg
cgtcaggcggaaatggaggtgaaacacttagggtatgcttcacatctggtggacatttcc
tgtgactctggggaaagcacccagggcacttccctaacccagcaagggtcaccaggcaga
gcaatacccaccgagaaggcagttgttgaatacgaatatgatgtcagagctgcagacgtt
tgtgtggggcctggcggccctgagctcaatttgcaggagaaggtgtccctacaaggaacg
ttctttgagcaacaggctgctttggcagacgtgagcccccaggcaccactgtattcgtat
gcccctcagctccgacacctggaccagttgctgcaggagcacgtgggcacagaagaggag
cgagaggaagagccgtcgaccacactggtggattgggaccctcggaccggcaggctgtgc
ataccgtccttccctagctttgaacatggctcagagggagacaagcagcctgagtccaag
gagctcgtggaggagggccttttgtctagactgtatgaggagcaggctccagacaagccg
tcggaagacaacgaaaccgacctcctgaaatttatggaggaatggggactctatgtgcag
atggaagactga

KEGG   Felis catus (domestic cat): 101086811
Entry
101086811         CDS       T02385                                 
Symbol
IFNGR1
Name
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04066  HIF-1 signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101086811 (IFNGR1)
   04066 HIF-1 signaling pathway
    101086811 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101086811 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101086811 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101086811 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    101086811 (IFNGR1)
   04659 Th17 cell differentiation
    101086811 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101086811 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086811 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101086811 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    101086811 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    101086811 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101086811 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101086811 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101086811 (IFNGR1)
   05140 Leishmaniasis
    101086811 (IFNGR1)
   05142 Chagas disease
    101086811 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101086811 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101086811 (IFNGR1)
   04090 CD molecules [BR:fca04090]
    101086811 (IFNGR1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101086811 (IFNGR1)
CD molecules [BR:fca04090]
 Proteins
  101086811 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Comm Adeno_E3_CR2 TMIE
Other DBs
NCBI-GeneID: 101086811
NCBI-ProteinID: XP_003986655
Ensembl: ENSFCAG00000030336
UniProt: M3XA82
LinkDB
Position
B2:complement(126545404..126567316)
AA seq 469 aa
MALLLLLVLVFQVGSRAEINAADLELSSVPKPTNIEIKAYNFNSVLSWDYPTMSQTPVFI
VQVKNYGEAIWVDACNTSHHSCNIFSAITDPSLSLWARIKARLGQKESAYAESKEFILCK
QGKIGPPELGIRNMEKHIIIDIFHPLAIISGMEPVAIYGEENCYSFKYEVHLRINGNETS
YKTDVEEDNCNETQCYLTVPVSSLDSEYCAWTKGFSDTWLVTTEQSKELCVTTLDGKHME
DSVWVPVVAVLLLFVVLVVVFVCCYTKKINPFKRRTIMLPKSLLSVVKNASSETKSESKC
VSPITYQPIVSENEKMVWEEQLSPATISDLPAEDSLEKMGHHEELQVVTPEGTISDMAPD
SPQTPVMRESSVRSNSNQSETCVVALNSYHSRNGSESGTVESQSFSDSEFPPSSKPEIKT
EEQESVMLRNTTTSFGYDKPHVLVDLLVDEGGKESLIGYRLTADSKEFS
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggctctcctccttctgctcgtcctcgtcttccaggtcgggagtagggctgagattaac
gccgcggatctggagctgtcttcggtgccaaaaccaacgaatattgaaattaaggcctat
aactttaatagtgtcctatcttgggactacccgaccatgtcacagacccctgtttttatc
gtacaagtaaagaactatggggaggcaatctgggttgatgcctgcaatacctctcatcat
tcttgtaatatcttttccgcaattaccgatccatcactttctctctgggccagaattaaa
gctagacttggacaaaaagaatcagcctatgcagagtccaaagaatttattttgtgtaaa
caagggaaaattggaccacctgaactgggcatcagaaacatggaaaaacacatcattatt
gacatatttcaccctttagctattataagtggaatggagccagtagccatatatggtgaa
gaaaattgttactcattcaagtacgaggtgcatctgagaataaatggaaatgagacctca
tataaaacggacgtagaggaagataattgcaatgagactcagtgctatctaactgtccca
gtgtcctcgttggattctgagtactgtgcttggacaaaaggattctcagacacatggctt
gttacaactgaacagtccaaagaactttgtgttaccactttggatggcaaacacatggaa
gattctgtttgggttccagttgttgccgttctcttactttttgtagttctcgtcgtggta
tttgtatgttgttacactaagaagattaatccctttaagagaagaaccatcatgttacca
aagtccctgctctctgtggtgaaaaatgcctcttcggagacaaaatctgaatcaaaatgt
gtatcacccatcacctaccaaccgatcgtctcagaaaatgagaagatggtctgggaagag
cagttgtctccagcgacaatttccgatctgcccgctgaagacagtctggaaaaaatggga
caccacgaagaactacaagtggtgacccctgaagggactatttctgacatggctcctgat
agccctcagaccccggtaatgagagagagttctgtccgttcaaatagtaaccagtctgaa
acctgtgttgtcgctttaaactcctatcactccagaaatggttccgagagcggcactgtg
gaatcgcagagcttctcggactcagaatttcccccaagtagtaaacctgaaataaagacc
gaggaacaggagtccgtaatgctgagaaacacgaccacctcctttggttatgacaagccg
cacgtattagtggatctgctggtggatgaaggcggtaaggaatccttgatcggttacaga
cttacagcagattccaaagagttttcctga

KEGG   Felis catus (domestic cat): 101087601
Entry
101087601         CDS       T02385                                 
Symbol
IL10RA
Name
(RefSeq) interleukin-10 receptor subunit alpha isoform X1
  KO
K05134  interleukin 10 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101087601 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101087601 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101087601 (IL10RA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101087601 (IL10RA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101087601 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101087601 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101087601 (IL10RA)
   04090 CD molecules [BR:fca04090]
    101087601 (IL10RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101087601 (IL10RA)
CD molecules [BR:fca04090]
 Proteins
  101087601 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101087601
NCBI-ProteinID: XP_003992449
Ensembl: ENSFCAG00000011763
UniProt: M3WFQ1
LinkDB
Position
D1:15647656..15659651
AA seq 578 aa
MLPRLVVPLAVLLSLRLCSGAHGTELPSPPSVWFEAEFFSHILHWTPIPNQSESTYYEVE
LLRYGRDSWESTPSCNQTLVLSCDLTIMTLDLYHDNSYKARVRAMAGNRYSNWTNTNTRF
SLDEVTLMVSVKLQVDNGIILGRIQLPRPGIAPTGDTYESIFQHFREYEIKLRKVPGNST
FIKQKINRETFSLSPPGELGEFCVKVKPSVASRVNRGLWSKEECIVLTPQYFTVTNLIIF
FTFVLLLCGALAYCLALQLYVRRQRKLPTVLVFGKPHPFNLVLQLSCPEPQDTIHPLDEG
AFPKVSPELKNSELHGSTDSGFGSAKSSLQNEGSQFLLPVPHPQAAGTVGKGAPREPENS
RSGGSSNSTDSGICLQEPSPSPGTGPHWEQRVRKSSQGQDDSGLGLAQNSEGQPGDVQGV
SDLGRVNPPGPEVPGEEDPASVAFRGYLKQTRCTQERATTAGCLEEEPASTDGLGPKFRT
CLDAEADWPPLALAKGYLKQDPGTTRPASGTPTGQWSRPTEEWSLLGLTSSRDLGASDCN
LAHDLAPLDCMAAPGGLLDRFDSNLVTLPLISSLHSNE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgctgccgcgcctggtagtgccgctggcggtgctcctcagcctgcgcctctgctccggc
gcgcacggaacagaacttcccagccctccatctgtgtggtttgaagcagaatttttctcc
catatcctccactggactcccatcccgaatcagtcagaaagcacctactatgaagtggag
cttctgaggtatggaagagactcctgggagtccacccccagctgtaaccagaccctggtg
ctgtcctgtgatctcactattatgaccctggacctgtaccacgacaatagctacaaagcc
agggtccgggcaatggctggaaaccggtactccaactggaccaacaccaacacccgcttc
tccctggatgaagtgactctgatggtcagcgtgaagctacaggtggacaacggcatcatc
ctcgggcggatccagctccccaggcccgggatcgcccctacaggcgacacttacgaaagc
atcttccaacacttccgagagtatgagattaagctgcgcaaggtgccggggaactctacg
ttcataaagcagaagataaaccgtgaaaccttcagcctctcacctcctggagaactggga
gaattctgtgtcaaggtgaagccatctgtggcctcccgagtgaacagggggctgtggtcc
aaggaagagtgcattgtgcttaccccacagtatttcaccgtgaccaacctcatcatcttc
ttcaccttcgtcctgctgctctgcggagccctggcctactgcctggccctccagctgtac
gtgcgacgccagaggaagctgcctaccgtcctggtcttcgggaagccccatccgttcaac
ttggtcctccagctctcctgcccagagccccaggacaccatccatccccttgacgagggg
gccttccccaaagtgtccccggagctgaagaactcggaactgcacggcagcacggacagc
ggctttggcagtgcgaagtcatccctgcagaatgaggggtcccagttcctcctgccggtc
ccccacccccaggcggcggggactgtgggaaagggggcgccccgagagccggagaacagc
cgcagcgggggcagcagcaacagcacagacagcgggatctgcttgcaggagcccagcccg
agtcctggcaccggaccccactgggagcagcgggtgaggaagagcagccagggccaggac
gacagcggcctcggtctagcccaaaactcagaagggcagcctggggatgtgcagggggtc
tcagacttgggccgtgtcaatcccccagggcctgaggtgcctggggaggaagacccagcc
tcagtggcattccggggctacctaaagcagaccagatgcacacaggagagagcaaccacg
gcaggctgcctggaggaagagcctgcctcgacagatggcctcggccccaagttcaggaca
tgcctggatgccgaggctgactggcccccgctggccctggccaagggctatttgaaacag
gacccaggaacgactcgccctgcatcagggaccccaaccggacagtggagtcggccaact
gaggagtggtcacttctgggtttgaccagctccagggacctaggagcatctgactgcaac
ttggcccatgacctggcccctctggactgtatggcagccccaggtggtctcctggaccga
tttgactcaaacctggtcactctgcctctgatctccagcctgcactcgaatgagtga

KEGG   Felis catus (domestic cat): 101087763
Entry
101087763         CDS       T02385                                 
Symbol
IL23R
Name
(RefSeq) LOW QUALITY PROTEIN: interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04659  Th17 cell differentiation
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101087763 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101087763 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101087763 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087763 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101087763 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101087763 (IL23R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101087763 (IL23R)
SSDB
Motif
Pfam: IL6Ra-bind IL12p40_C fn3 Pur_ac_phosph_N Lep_receptor_Ig
Other DBs
NCBI-GeneID: 101087763
NCBI-ProteinID: XP_023114577
Ensembl: ENSFCAG00000001939
LinkDB
Position
C1:55937670..55994453
AA seq 631 aa
MNQVTIQWDVVIAIYIFFNWCHGGITNINCSGHMWVEPATVFKMGMNVSIYCQAEIKNCQ
PKKLYFYKNGIKERFRITRINKTTARLWYNNFLEPHASMYCTAECPGYFQETLICGKDIS
SGYPPDVPDKVTCVIYEYSGNMTCTWNSGKPTYIDTMYVVYVKSLETEEEQQYLSSSYIN
ISTDSLQGGKKYLVWVQAANALGTEKSKQLQINLDDIVIPSASIISRAEDINTTVPKTVI
HWNSQTTIEKVSCEMRYKSKTNQTWKVKEFDTNFTYEQQSEFYLEPNTKYIFQVRCQETG
KRYWQSWSSPFFHKTTETVPQVTLKSFQHDTQNSGLLIASIFKGHVTADNRQQDIGFLLG
MIFFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLHEDIPNIENSSIVKMLQEKSEFT
DNNSSEQVPYVDPVVTEIEIFLPEEHKPTDYKMEKNTESLETRDGLQKSLLTNTTVVYIP
GLSPGYKPQISTFLTGGNHLSKNDETASSTLKPPADSIDLGKNAMFKKYPNFAFPVSSMN
SLSNTLFLEELSLILNQGECSPLDMQNSVEGETTMLLENVSSNETLPEQTLLPDEFVSCL
GIMNEELPSINSYFPQNILENHFNTISLLEK
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaatcaggtcacaattcaatgggatgtggtaatagctatttacatattcttcaactgg
tgtcatggaggaattacaaatataaactgctctggccacatgtgggtagaaccagccaca
gtttttaagatgggtatgaatgtctctatatattgccaagcagaaattaagaactgccaa
ccaaagaaactttatttttataaaaatggcatcaaagaaagatttcgaatcacaagaatt
aataaaacaacagctcggctttggtataacaactttctggagccacatgcctctatgtac
tgcactgctgaatgtcctggatattttcaagagacattgatatgtggaaaagacatttct
tctggatatccaccagatgttcctgacaaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgtacctggaattctgggaagcccacctacatagacacaatgtatgtggtg
tatgtgaagagtttagagacagaagaagagcaacaatatctttcgtcaagttatattaac
atctccactgattcattgcaaggtggcaagaaatatttggtttgggtccaagctgcaaat
gcattgggcacagagaagtcaaaacaactgcaaattaatctggatgatatagtgatacct
tctgcatccatcatttccagggctgaggacataaatacgacagtacccaagaccgtgatt
cactggaatagtcaaacaacaatagaaaaggtttcctgtgaaatgagatacaagtctaaa
acaaaccaaacttggaaggttaaagaatttgacaccaattttacatatgagcaacagtca
gaattctacttggaaccaaacactaagtatatatttcaagtgagatgccaagaaacaggt
aaaaggtactggcagtcctggagttcacccttttttcataaaacaactgaaacagtcccc
caggtcacactgaaatcattccaacatgatactcagaattctgggcttctaattgcttcc
atctttaaaggacacgttactgctgacaacaggcaacaagacattggatttttattggga
atgatcttctttgctgtcatgttgtcgattctttctttgattgggatatttaacagatct
ctccgaactggaattaaaagaagaatcttattgctaataccaaagtggcttcatgaagat
attcctaatatagaaaacagtagtatcgtaaaaatgctacaggaaaaaagtgaatttaca
gataataattccagtgaacaggtcccatatgttgatccagtggttacagagatagaaatc
tttctcccagaagaacacaaacccacagactataagatggaaaagaatacagaatccctg
gagaccagagacggcctgcaaaagtcactactcaccaacactacagttgtatatattcct
ggcctcagccctgggtataaaccccagatttcaacttttctcactgggggaaaccatctc
agcaaaaatgatgaaacagcttcctcaactctcaaaccaccagctgattccatagacctc
gggaaaaatgccatgtttaaaaaatatcctaattttgctttccctgtctcaagtatgaat
tcactaagcaacacactatttcttgaagaattaagccttattctgaatcaaggagaatgc
agtcctctggacatgcaaaactcagtagagggagaaactaccatgcttttggaaaatgtt
tcatccaatgaaactcttccagaacagactctgttgcctgatgaattcgtctcctgtttg
gggatcatgaatgaggagttgccatccattaattcttattttccacaaaatattttggaa
aaccacttcaataccatttcactcttggaaaagtag

KEGG   Felis catus (domestic cat): 101088012
Entry
101088012         CDS       T02385                                 
Symbol
IL12RB2
Name
(RefSeq) interleukin-12 receptor subunit beta-2 isoform X1
  KO
K05064  interleukin 12 receptor beta-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101088012 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101088012 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101088012 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088012 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101088012 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101088012 (IL12RB2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101088012 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101088012
NCBI-ProteinID: XP_023114578
Ensembl: ENSFCAG00000001940
LinkDB
Position
C1:56033971..56113955
AA seq 861 aa
MAQTNGGCSLALIFIIVLLLAKANIDVCKRGDVTVKPSRVISLGSAVNISCSLKPEQGCS
QYPSVNRLILYKFDRQIHFLHGYSLSSQVTGLPLGTTLFLCKLACSKNKEFRICGAEISV
GVVPEQPQNLSCIQKGKHGTVTCIWDRGRDTHLYTAYTLQLTGPKNFTWQRQCNDHYCDH
LDLGINLTPELPESSYTAKVTATNSLGNASSIPSTFTFLDIVRPLPPWDIRIKCVNASVS
RCILQWRDEVLVLLNRLRYRPNSSRSWTMVNATNAKGRQDLLDLKPFTEYEFQISSKLHL
YKGSWSDWSEPFRTQTPEEEPTGTLDVWYMKQPIDYNRQQISLFWKNMSVSEARGKILHY
LVTLQEVAGGKVTMQNITEHTSWTWIIPRTGNWAATVSAANSKGSSPPTRINITDLCEAE
LLAPRQVSANSEGVDNMMVTWEPPGRAAPAVQEYVVEWREPHSGSDTRPPVNWLRSPPYN
VSALISGNIKPYSCYEICVCALSGDQRGCSSIRSNSKHKAPLSGPHINAISEEKGNIVIS
WNEIPAQEQMGCILHYRIYWKEQYSNSQPQLCEIPYRVSPNSHSIDSLQPGVTYVLWITA
LTAAGESPPGNKREFHLQGKANWSVFVAPSICVAVVIVGIFSTRYFRQKVFVLLSALRPQ
WCSKEIPDPANSTWAKKYPTVEEKMQLPLDRLLTDWPTPEEPEPLVISEVLHQVTPVFRH
PHHPNWPDKGQEIQGHYTSEEDTGYSASSLPPPKALIAETGLVDLYKMLGSRSPDSKPGH
LAGPVTVLPVDYLPTHEGYLPSNIEYLPSHEAPITDPLEELKPQHISLSIFPSSSLHPLT
FSCDKQLTLDRLKMGCSSLML
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcacaaacaaatggagggtgttcactggcacttatttttatcattgtgttgttgttg
gctaaagcaaatatagatgtatgcaagagaggagatgtgaccgtgaagccttcccgtgta
atttcacttggatcagctgtcaatatttcatgctctttgaagcctgaacaaggctgctca
caataccccagtgttaacaggttaatcctctacaagtttgacagacaaatccattttctg
catggttactccctcagttctcaagtcactggtcttcctctgggtacaaccctgtttctc
tgcaaattggcatgtagcaaaaacaaggagtttcgaatatgtggggcagagatctcagtt
ggtgttgttccagaacagcctcaaaacttatcttgtatacagaagggaaaacatgggacc
gtaacctgcatctgggacagaggacgagacacccacctatatacagcatatactttacag
ctaactggaccaaaaaatttcacttggcagaggcaatgtaatgatcattattgtgaccat
ttggaccttggaattaacctaacccctgaattgcctgaatccagttacacagccaaggtt
actgctacaaatagtcttggaaatgcttcttcaattccatccacatttacgttcttggac
atagtgaggcctcttcctccatgggacatcagaatcaaatgtgtaaatgcttctgtgagc
agatgtatccttcagtggagagatgaggtgctggtgttgcttaatcgactcagatatcgg
cccaacagcagcaggtcctggactatggtcaatgctacaaatgccaaaggaagacaggat
ctgctggatctgaaaccatttacagagtatgaatttcagatttcttctaagttacatcta
tataaaggtagttggagtgattggagtgaaccattcaggacacaaacaccagaagaagag
cctactgggacattagatgtctggtacatgaaacaacccattgactacaatagacaacag
atttctcttttctggaagaatatgagtgtatctgaggcaagagggaaaatcctccactat
ctagtgaccttgcaggaggtggcaggggggaaagtcacaatgcagaacatcacagaacac
acctcctggacctggatcattcccagaactggaaactgggctgcaactgtgtctgcagcc
aactcaaaaggcagttccccgcctactcgtattaacataacggacctgtgtgaggcagag
ttgttggctcctcgtcaggtctctgcaaactcagagggcgtggacaacatgatggtgacc
tgggagccccctgggagagccgcccctgctgtccaggaatatgtggtggaatggagggag
ccccattccgggagtgacacgcggccccctgtaaactggctgcggagtcccccctacaat
gtgtccgctttgatttcagggaacataaaaccctacagctgttacgaaatctgcgtgtgt
gcactgtcgggggaccagagaggatgcagctccatccggagtaactctaagcacaaagca
ccactgagtggcccccacattaatgccatctcagaggaaaaggggaacattgtgatttca
tggaacgaaattccagcccaggagcaaatgggttgcatcctccattacaggatatactgg
aaggaacagtactctaattcccagcctcaactttgtgaaattccctatagggtatcccca
aattcacattcaatagacagcctgcagcccggagtaacatatgtcctgtggataacagct
ctgacagctgctggtgaaagccccccaggaaacaagagggaatttcatctgcaaggtaaa
gccaactggagtgtgtttgtggcaccaagcatttgcgttgctgtcgtcatagtgggcatt
ttctcaacgcgttacttccggcaaaaggtatttgttctcctttcagccctcagacctcag
tggtgtagtaaagaaattccagacccagccaatagtacttgggccaagaaataccccact
gtggaggagaagatgcagctacccttggacaggctcctgacagactggcccactcctgaa
gaacctgagcctctggtcatcagtgaagtcctgcatcaagtgaccccagtcttcagacat
cctcatcaccccaactggccagacaagggacaagaaatccaaggtcactatacctctgag
gaagacacaggatatagtgcctcaagcctaccacctcccaaagctctcatagcagagaca
ggactagtggatctgtacaagatgttggggagcaggagccctgactcaaagccaggacac
ctagctggccccgtgacagtactcccagtggactaccttcccacccatgagggatactta
ccctccaacatagagtatcttccttcacatgaagctcctataactgatcctctggaagaa
ctaaagcctcagcacatctctctttccattttcccctcaagttctcttcacccactcacc
ttttcctgtgataagcagctgactctggatcggttaaagatggggtgcagctccctcatg
ctgtga

KEGG   Felis catus (domestic cat): 101089787
Entry
101089787         CDS       T02385                                 
Symbol
CSF3R
Name
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101089787 (CSF3R)
   04151 PI3K-Akt signaling pathway
    101089787 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089787 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101089787 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089787 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089787 (CSF3R)
   04090 CD molecules [BR:fca04090]
    101089787 (CSF3R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101089787 (CSF3R)
CD molecules [BR:fca04090]
 Proteins
  101089787 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101089787
NCBI-ProteinID: XP_003989914
Ensembl: ENSFCAG00000013269
LinkDB
Position
C1:complement(28171321..28185022)
AA seq 839 aa
MVELGTWSLTRAALIILLLPRSLEECGHISLPTSAVRLGDSITASCTISPNCSHLGPESQ
ILWKLGTQLQLGERQQRLADGSQESTITLPPLNRPRDLLSCCLRWGNSVQILDQAELWAG
YPPAAPHNLSCLMNLTTNSLICQWEPGPHNHLPTNFTLKSFKSRDNCQTQEDSILDCVPK
DGDSHCSIPRKYLKLYRHMGIWVQAENALGTGKSPQLCLVPMDVVKLEPPTLWALAPSPE
VAPPQPGCLLLRWELWKPSLYIEQKCELRHQPQLGEASWALVGPLLPETLQYELCGLLPS
TAYVLQMRCVRWPLPGQWSDWSPSLILTTAQQAPIVRLDTWWRQRQLDPRTVDVQLFWKP
VPLDKYSGQIQGYLVRPPGQTGAVPALCNTTELSCTFHLPSEAREVVLVAYNTAGTSHPT
PVVFLESRGPPLARLHTTARDPHSLWVGWEPPSPRPRGYVIAWGLGPPSPSSSNMTWKME
HNGNISGTLLQENIRPFQLYEITVTPLYQDTVGPSQHIYAYSQEMAPSHTPELHLKHIGK
TWAQLEWEPQAPELGKSPLTHYTVFWTNAQDQSFFTTLNASSHGLVLHGLEPASLYHVCL
MASSKAGATNSTSLTLMTLALEESELHILLGLFGLLVLLICLCGASRFCCRPSRKNPLWP
SVPDPAHSSLGSWVPTIMVEEAFQLPSLRDPGMPPITKITVLEEEEKKPGPWESNDSSGT
CGLPTLVQAYVLQGDPRTPSTQPQPPSSTNDQVFYGQVLGSPTGPGPGHYLRCDSTQPLL
GGLTPSPKFYENLWFQNSPLGTPEPLVPNQEDDCVFGPLLDFPLLQGLQVHGVEGLGGI
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggtggagctgggaacctggagcctgaccagagctgccctgattatcctgctgctcccc
agaagcctggaggaatgcgggcacatcagcctcccaacctccgctgtccgcctgggggac
tccatcacagcctcctgcaccatcagccccaactgcagccacctgggcccggagtcacag
attctgtggaagttgggaacacagcttcagctcggagagaggcagcagcgtctggcagat
ggaagccaggaatccaccatcacgctgcccccgctcaaccgcccgcgggaccttctctcc
tgctgcctgcgctggggcaacagcgtgcagatcctggaccaggctgagctgtgggcaggc
taccctcccgccgcgccccacaacctgtcctgcctcatgaacctcacaactaacagcctc
atctgtcagtgggagccaggaccccacaaccacctgcccaccaacttcaccctcaagagc
ttcaagagccgggacaactgccagacccaagaggactccatccttgactgtgtgcctaag
gacggagacagccactgctctatcccacgcaaatacctgaagttgtaccggcacatgggc
atctgggtgcaggcagagaacgcactagggactggaaagtcgccacagctgtgcctcgtt
cccatggatgtcgtgaagctggagccccccacactgtgggccctggcccccagccctgag
gtggccccaccccagccaggctgcctgctgttgcgctgggagctatggaagccgagcctc
tacatagaacagaaatgcgagctgcgccaccagccacagcttggagaagccagctgggcc
ctggtgggccccctgctccctgagaccctccagtatgagctctgtgggctcctcccatcc
acagcctacgtcctgcaaatgcgctgcgtccgctggcccctgcctggccagtggagcgac
tggagccctagcctgatactgaccaccgcacaacaggcccccatcgtcagattggacaca
tggtggcggcagaggcagctggaccccaggactgtggatgtgcagctgttctggaagcca
gtgcccttggacaaatacagcgggcagatccaagggtacctggtcagaccaccaggccag
actggggcagtcccagccctctgcaacaccacggagctaagctgcaccttccacttgccc
tcggaagcccgggaggtggtccttgtggcctataacacagcggggacctctcatcccacc
ccagtggtcttcctggagagcagaggcccgcccctggccaggctccacaccacagctcga
gacccccacagcctctgggtgggctgggagccccccagccctcggcctcggggctatgtg
attgcgtggggcctgggtccccccagccccagcagcagcaatatgacctggaagatggaa
cacaacgggaacatttccgggaccctgctgcaggagaacatcaggccctttcagctctac
gagatcaccgtgacccctctataccaggacaccgtgggaccctcccagcacatctatgcc
tactcccaagagatggccccctcccacaccccagagctgcatctaaagcacatcggcaag
acctgggcccagctggagtgggagccccaggcccctgagctggggaagagccccctgacc
cactacaccgtcttctggaccaacgctcaggaccagtccttcttcaccaccctgaatgcc
tcctcccatggcttggtcctccacggcctggaacctgccagcttgtaccacgtatgcctc
atggcttccagcaaggccggggccaccaatagtacaagccttaccctgatgactttggcc
ctagaggagtctgagctgcatatcctcctgggcctctttggcctcctggtcctgctcatc
tgtctctgtggggcttcccggttctgctgcagacccagcaggaagaatcccctctggcca
agtgtcccagacccagcccacagcagcctgggctcctgggtgcccaccatcatggttgag
gaggccttccagctgcccagccttcgggaccccggcatgccacccatcaccaagatcaca
gtactggaggaagaagagaagaagccggggccctgggagtccaacgacagctcagggacc
tgtggcctccccaccctggtccaggcctatgtgctccagggggacccaagaacaccttcc
acccagccccagcccccgtctagcaccaatgaccaggtcttttatgggcaggtgctgggc
agccccacaggcccaggtccagggcactacctccgctgtgactctactcagcccctccta
gggggccttactcccagccccaagttttatgagaacctctggttccagaacagccccctg
gggaccccagagcccctcgtcccaaaccaggaggatgattgtgtctttgggccactgctt
gacttccccctcctgcaagggctccaggtccatggggtggaggggctggggggcatctag

KEGG   Felis catus (domestic cat): 101089832
Entry
101089832         CDS       T02385                                 
Symbol
IL6ST
Name
(RefSeq) interleukin-6 receptor subunit beta isoform X1
  KO
K05060  interleukin 6 signal transducer
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  JAK-STAT signaling pathway
fca04659  Th17 cell differentiation
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101089832 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089832 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101089832 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101089832 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101089832 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089832 (IL6ST)
   05203 Viral carcinogenesis
    101089832 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101089832 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101089832 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089832 (IL6ST)
   04090 CD molecules [BR:fca04090]
    101089832 (IL6ST)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101089832 (IL6ST)
CD molecules [BR:fca04090]
 Proteins
  101089832 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind Pur_ac_phosph_N fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 101089832
NCBI-ProteinID: XP_011281197
Ensembl: ENSFCAG00000010859
UniProt: M3WE28
LinkDB
Position
A1:complement(126562088..126617728)
AA seq 918 aa
MLTLKTWIVQALFIFFTTESVGELLEPCGHIKPESPVVQLGSNFTAVCVLKEKCMDYFHV
NANYIFWKTNHVTVPKEQYTIINRTASSVTFTDISLLNIQLTCNIRTFGQIDQNVYGIRI
ISGLPPEKPKNLSCIVNEGKKMMCQWDPGRETYLETNFTLKSEWATEKFADCKTKRDTPT
SCTVDYSPVYFVNIEVWVEAENALGKVTSDHINFDPVDKVKPNPPHNLSVSNSEELSSIL
KLTWINSSIQSFIRLKYNIQYRTRDASTWSQIPPEDTASSRTSFTVQDLKPFTEYVFRIR
CMKEDGKGFWSDWSEEASGITYEDRPSKAPSFWYKIEPSHTHGYRSVQLIWKTLPPFEAN
GKILDYEVTLIRWKSRLQNYTVNDTKWTVNLTNDRYIATLTARNLVGKSDAAVLTIPAYN
FQATRPVTDLKAFPKDNMLWVEWTAPNESVNKYILEWCVLSDKSPCIPDWQQEDGTVHRT
FLRGNLAESKCYLITVTPVYTDGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQIYSDGNFTDVSVVEIEAANDKKPFPEDLKSLDLFKKEKI
STEGHSSGIGGSSCMSSSRPSISSSDENESAQNTSGTVQYSTVVHSGYRHQVPSVQVFSR
SESTQPLLDSEERPEDLQLVDNTDSSVGNLPRQQYFKQNCSQRETSPDISHFERSKQVSS
VNEEDFVRLKQQISDISQSCGSGQMKMFQEISVADAFGLHTEGQVERFETVGMEAAVDEG
MSKSYLPQTVRRGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacattgaaaacttggatagtgcaagcgttgtttattttcttcaccactgaatct
gtaggtgaacttctagagccatgtggtcatatcaaacctgaatctccagttgtacaactt
ggttctaatttcactgcagtttgtgtgctaaaggaaaaatgcatggattattttcatgta
aatgctaattacattttctggaaaacaaaccatgttactgttcctaaagaacaatatacc
atcataaacagaacagcatctagtgtcacatttacagatatatctttattaaatattcaa
ctcacttgcaacattcgtacatttggacagattgatcagaatgtttatggaatcagaata
atttcaggcttgcctccagaaaaacctaaaaacttgagttgcattgtaaatgaaggaaag
aaaatgatgtgtcagtgggatcctggaagggaaacatacctggaaacaaacttcacttta
aaatctgaatgggcaacggagaagtttgctgattgtaaaacaaaacgtgacacccccacc
tcatgcactgttgattattctcctgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatataaattttgatcctgtagataaagtg
aagcccaatccaccacataatttatcagtcagcaactcagaggaactgtctagtatctta
aaattgacatggatcaactcaagtattcagagttttataagactgaaatataacattcaa
tataggaccagagatgcctcaacctggagccagattcctcctgaagatacagcatccagt
agaacttctttcactgtccaggaccttaagcctttcacagaatatgtgtttaggattcgt
tgtatgaaggaagatggtaaaggattctggagtgactggagtgaagaagccagtgggatc
acatatgaagacagaccatccaaggcaccaagtttctggtataagatagagccatcccat
actcacggctatagatctgtgcaactcatatggaagacgttgcctccttttgaagccaat
ggaaaaattttggattatgaagtgactctcataagatggaaatcacgtttacagaattat
acagtgaatgacacaaaatggacagtaaacctcacaaatgatcgttacatagcaactctg
acagcaagaaatctggttggcaaatcagatgcagctgttttaactatccctgcctataac
tttcaagctactcgcccggtcacggatcttaaagcatttcccaaagataatatgctttgg
gtagaatggactgctccaaatgaatctgtaaacaagtatatacttgagtggtgtgtatta
tcagataaatcgccgtgcatcccagactggcaacaagaagatggcactgtacaccgcacc
tttctaagagggaacctagcagagagcaaatgttatttgataacagttactccagtatat
actgatggaccaggaagccctgagtctataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacgaaaaaagtagggaaaaatgaagctgtcttagagtgggac
caacttcctgttgatgttcagaacggatttatccgaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcctcccacacagaatatacactgtcc
tctttgaccagtgacaccttgtacatggtacgaatggcagcatacacagacgaaggtgga
aaggatggcccagaattcacttttactacaccgaagtttgctcaaggagaaattgaagcc
atagttgttcctgtttgcctagcatttctattgacaacccttttgggagtattgttctgc
tttaataagcgagacctaattaaaaaacatatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcatacacctcctaggcataattttaattcaaaagat
cagatttactcagatggcaatttcactgatgtaagtgtcgtggagatagaagcagcaaat
gacaaaaagccttttccagaagatctgaaatcactggacttattcaagaaggaaaaaatc
agtactgaaggacacagcagtggtattggaggttcatcgtgcatgtcctcctctaggcca
agcatttctagcagtgatgaaaatgagtctgcccagaacacttcaggcaccgtccagtat
tccacagtggtgcacagtggctacagacaccaggttccatcggtccaagtcttctcaaga
tccgagtccacccagcccttgttagattctgaagagcggccagaagatctacagctggta
gataacacagatagcagtgttggcaatttgcccaggcaacagtatttcaaacaaaactgc
agtcaacgtgaaaccagtccagatatttcacattttgaaaggtcaaagcaagtttcgtca
gtcaatgaagaagattttgttagactcaaacagcagatttcagatatttcacagtcctgt
ggatctgggcaaatgaaaatgtttcaagaaatttctgtagcagatgcttttggtctacat
actgagggacaggtagagagatttgaaacagttgggatggaggctgcagttgatgaagga
atgtctaaaagctacttaccacaaactgtcagacgaggtggctacatgcctcagtga

KEGG   Felis catus (domestic cat): 101089988
Entry
101089988         CDS       T02385                                 
Symbol
IL27RA
Name
(RefSeq) LOW QUALITY PROTEIN: interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101089988 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101089988 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101089988 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101089988 (IL27RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101089988 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 101089988
NCBI-ProteinID: XP_006928550
Ensembl: ENSFCAG00000003723
LinkDB
Position
A2:9972984..9990073
AA seq 628 aa
MRGARAAPFRPRPELVLLPLLSLLCHRSRPQGSPGPLQCYGVGPLGDLNCSWGPLGDLAA
PSTLHLQSQKYHPNRTWTVTVPTGQSWVTIPREQLTMSDELLVWGTEAGQPLWPPVFVNL
ETRMKPDAPRLYPDVDFSEDDPLEATVHWAPPVWPPHKVLVCQFYYQRCQGTAWTLLEPE
VKSIPLTPVEIQDLELATGYRVYGRCRMENEEGLWGHQSPVLSFQTPPSDVWISGNVCGT
AGTQEALLLWKAPGHCVRMSYKVWFQIKGQELIRKTAACCNFSIPSQAGWVGLSAVNATS
WKPLTNLSLACLGPSAAPHGVVVRSVAGSPELLVTWQRGSGELQEHVVDWARDGDPLDAL
NWIRLPPENLRALLPGEFEGGVPYRITVTAVSPCGLAPAPSVWRFTEELVPLAGPTLWRL
QDTPPGTPAIAWGEVPRRQLRGHLTHYTLCTQSGTGPSVCMNVSGSARNITLPDLPWGPC
ELWMTASTIAGQGPPGPSLRLHLPDNTLKWKVLPGVFLLWGLLLMGCGMSLATSGRCLHL
RHKVLPRWVWEKVPDPANSNSGQPHMEEMPQAQPLGDFPILKVEEMEPLPVAEPPQASTR
LDSGYEKHFLPTPEELGLLGPPRPQVLA
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgaggggcccgggccgctcccttccggccgcggccggagctggtgctgctgcctctg
ttgtcgctgctgtgccaccggagtcgaccccagggaagtcccgggccactgcagtgctat
ggagttggacccttgggcgacttgaactgctcgtggggacctcttggggatctggcagcc
ccctccacgctgcacctccagagccagaagtaccatcccaacagaacgtggactgtgaca
gtgcccactgggcagagctgggtgaccattccgcgggaacagcttaccatgtctgatgaa
ctgcttgtctggggtaccgaggccggccagcctctctggcccccagtcttcgtgaacctg
gaaacccgaatgaagccagatgccccccggctctaccctgacgtcgacttttcagaggat
gaccccttggaggccactgtccattgggccccgccggtgtggccaccccacaaggtcctg
gtctgccagttctactatcaaagatgccaggggactgcctggactctgctggagccagaa
gtgaagtccatacccctgacccccgttgagatccaggacctggagctagccactggctat
cgggtgtacggccgctgccgaatggagaacgaagagggtctgtggggccaccagagccct
gttctgtccttccagacgccgccctctgacgtatggatatcggggaatgtctgcgggaca
gcgggcacacaggaagccctgcttctgtggaaggccccgggccactgcgtgcggatgagc
tataaagtctggttccagattaaaggtcaggagctgatccggaagacggctgcctgctgc
aacttctccatccccagccaggcggggtgggtcgggctgtccgccgtcaatgccacgagc
tggaagcctctcacgaacctttctttggcctgcttgggtccaagtgctgccccccatggc
gtggtggtcaggagcgtggccgggagcccggaactgctggtgacttggcagcgggggtct
ggggagttgcaggagcacgtggtggactgggcccgggacggggatcccctggacgccctc
aactggatccggcttccccctgagaacctcagagcgctattgccaggggagtttgaagga
ggggtcccctaccgaatcacagtgacagcagtctctccttgcggcttggcccctgccccc
tcagtctggaggttcacagaggaactagtgcccttagcaggaccaacactttggcgactc
caggacacccctccaggaacccccgccatagcatggggagaggtcccaaggcgccaactt
cggggccatctcacccactacaccttgtgcacacagagcgggaccgggccttctgtctgc
atgaatgtgagtggcagcgcccggaacatcaccctgcctgaccttccctggggtccttgt
gagctgtggatgaccgcatccaccatcgcaggacagggcccacccggtcccagcctccgg
cttcacctaccagataacaccctgaagtggaaagttctgccaggtgtctttctcctgtgg
ggcttgctcctgatgggctgtggtatgagcctagccacctctggaaggtgcctccacctt
cggcacaaggtactgccccgctgggtctgggagaaggttcctgatcctgccaatagcaat
tctggccagcctcacatggaggagatgcctcaggctcagcccctcggggacttccccatc
ctgaaagtggaggagatggaaccactcccagttgcggagcccccccaggcctccacccgg
cttgactctgggtatgagaagcacttcctgcccacccctgaggagctaggccttctgggc
ccgcccaggccccaagttctggcctga

KEGG   Felis catus (domestic cat): 101090038
Entry
101090038         CDS       T02385                                 
Symbol
IL10RB
Name
(RefSeq) interleukin-10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090038 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090038 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101090038 (IL10RB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090038 (IL10RB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101090038 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090038 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090038 (IL10RB)
   04090 CD molecules [BR:fca04090]
    101090038 (IL10RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101090038 (IL10RB)
CD molecules [BR:fca04090]
 Proteins
  101090038 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101090038
NCBI-ProteinID: XP_003991512
Ensembl: ENSFCAG00000012214
UniProt: M3WGI9
LinkDB
Position
C2:complement(12074186..12099393)
AA seq 371 aa
MARGLRSWLGGCLLVSALGMVPPPENVRMKSVNFKNVLQWEVPAFPKGNLTFTAQYQSYK
KFQDMCTSTVLMECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTMIGPPGMQV
EALANSLHMRFLAPKIENEPETWTMRNIYNSWAYNVQYWKNGSDEKWPITCQYDFEVLRD
LEPRTTYCVQVQGFLPDRNKTGEWSEPVCEPTTNAETAPSWTVAVVLAASVCVAFLLLGC
SALLWCLYKKTKHAFSPGNCLPQHLKEFLGCPHHNTLLFSFPPSDDNEVFDKLSVITPAS
ESSTQNPGNGCTPGTLSGQGSSRLVPEGEVHPAEYSTPLVLSPASEGKWSGKPPGQTPNL
DPEDSETTSEQ
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcgcggggcctgcggagctggctgggcggctgcctcctggtgtcagccttaggaatg
gtgccacctcccgaaaatgtgagaatgaagtcagtgaatttcaagaacgttctacagtgg
gaggtgcctgcttttcccaaagggaatctgactttcacagctcagtaccaaagttataag
aaattccaagatatgtgcacaagtactgtcttgatggaatgtgatttctcaagtctttcc
aagtatggtgatcacaccttgagagtcagggctgaatttgcagatgagcactcagactgg
gtgaacatcaccttctgtcctgtggatgacaccatgattggaccacctggaatgcaagta
gaagcacttgctaattctttacatatgcgtttcttagcccccaaaatagagaatgaacct
gaaacatggaccatgaggaatatttataactcgtgggcttataatgtgcaatattggaaa
aatggctctgacgaaaagtggccgattacttgtcagtatgactttgaggtcctcagagat
cttgagccacggacaacttactgtgttcaagttcaagggtttcttcctgatcggaacaaa
accggggaatggagcgagcctgtgtgtgagccaacaaccaatgccgagactgccccgtcc
tggactgtcgccgtcgtcctggccgcctcggtgtgtgtggccttcctgctcctcggctgc
tccgccctgctgtggtgcctgtacaagaagaccaagcacgccttctcccctgggaactgt
ctgcctcagcacctgaaagagtttttgggctgccctcatcacaatacacttctgttctcc
ttcccgccctctgatgacaatgaagtctttgacaaactgagcgtcattacgccagcctct
gaaagcagcacacagaatcctggcaacggctgtaccccggggaccctgtcagggcagggc
tcctccaggctggtccccgaaggggaagtgcacccagctgagtacagcacccccctggtt
ctctcgcctgcatctgagggtaaatggagcgggaaaccacctgggcaaaccccaaatctg
gatcccgaagattccgagacaacatctgaacaatga

KEGG   Felis catus (domestic cat): 101090239
Entry
101090239         CDS       T02385                                 
Symbol
IL2RG
Name
(RefSeq) cytokine receptor common subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090239 (IL2RG)
   04151 PI3K-Akt signaling pathway
    101090239 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090239 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101090239 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090239 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101090239 (IL2RG)
   04659 Th17 cell differentiation
    101090239 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090239 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090239 (IL2RG)
   05162 Measles
    101090239 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101090239 (IL2RG)
   05340 Primary immunodeficiency
    101090239 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090239 (IL2RG)
   04090 CD molecules [BR:fca04090]
    101090239 (IL2RG)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101090239 (IL2RG)
CD molecules [BR:fca04090]
 Proteins
  101090239 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101090239
NCBI-ProteinID: XP_004000651
UniProt: M3WLD0
LinkDB
Position
X:complement(60411656..60415380)
AA seq 369 aa
MLKPPLPLRSLLFLQLPLLGVGLNSTGPKPNGNEDITADFFLTATPPAALSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPHPTNLTLHYWYKNSNDDRVQECGHYLFSGEITSGCWLQKE
EIHLYETFVVQLQDPREPKRQSTQRLKLQNLVIPWAPENLTLRNLSETQLELTWSNRHLD
HCLEHLVQYRSDWDRSWTEQSVDHRHSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEW
SRPIHWGSNTSKENPLLFAMEAVLIPLGSVGLIISLICVYCWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAP
PCYTLKPEP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaattcgacaggccccaagcccaatgggaatgaagacatcacagctgatttc
ttcctgaccgctacaccccctgcggccctcagtgtttccactctgcccctcccagaggtc
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
catcccaccaacctgactctgcactattggtacaagaactccaatgatgatagagtccag
gagtgtggccactatctattctctggagagatcacttctggctgctggctgcaaaaagag
gagatacatctctatgaaacatttgttgtccagctccaggacccacgggaacccaagagg
cagtccacacagaggctgaaattgcagaatctggtgatcccctgggctccggagaaccta
acgcttcgcaacctgagcgaaacccagctagaactgacctggagtaacagacacttggac
cactgtctggagcaccttgtgcagtaccggagtgactgggaccgcagctggacagaacaa
tcagtggaccacagacatagcttctctctgcctagcgtggatgggcagaaattctacacg
ttccgtgtccggagccgctataacccactctgtggaagcgctcagcgttggagtgaatgg
agccgcccgatccactggggcagcaatacttcaaaggagaatcctttgttgtttgcaatg
gaagctgtgcttatcccccttggctccgtgggattgattattagccttatctgtgtgtac
tgctggctggaacggacgatgccccggattcctaccctcaagaacctagaggatctggtt
actgaataccacgggaacttttcggcctggagtggagtatctaagggactggcggagagt
ctgcagccagactacagtgaatggctctgccacgtcagtgagattcccccaaaaggaggg
gctccaggggaggggcctgggggctccccctgcagccagcatagcccctactgggctccc
ccgtgttacaccctgaaaccggagccctga

KEGG   Felis catus (domestic cat): 101090285
Entry
101090285         CDS       T02385                                 
Symbol
IFNAR2
Name
(RefSeq) interferon alpha/beta receptor 2
  KO
K05131  interferon receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05160  Hepatitis C
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101090285 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    101090285 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101090285 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101090285 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101090285 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    101090285 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    101090285 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101090285 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090285 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101090285 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    101090285 (IFNAR2)
   05164 Influenza A
    101090285 (IFNAR2)
   05162 Measles
    101090285 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    101090285 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101090285 (IFNAR2)
   05169 Epstein-Barr virus infection
    101090285 (IFNAR2)
   05165 Human papillomavirus infection
    101090285 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101090285 (IFNAR2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101090285 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101090285
NCBI-ProteinID: NP_001265788
UniProt: G8IJB6
LinkDB
Position
C2:complement(12100255..12131244)
AA seq 523 aa
MLWSQNTSWIRPHDLYPVVYLVVCIGLMVGVVSAWPDLSDESCTLKVTFRSFRLILSWEL
KNHSIAPTHYTLWYTVMSKPDDMKIVEHCSNITASFCDLTDVWEVLPETYIPRVDGFRGN
TMLVSCISDFFLATHVSLEPPDFDIVGSTNHINVIVKFPPVIPKILNGELLQYYLPLVIE
EQSGKIVKKHHPKLNGNIIGNVTYVIDKLIPNTNYCVSVYFKSKDMGAINRSPVKCTFLQ
PGQETESSESAKIGGIIIMFLIAAVFISTILILKRVGYICLRNDFPKVLNFNNLSSWVFL
ERPPLETVAFVEVIHVNRKKKVWDYNYDDESDSNDEVAPPISGGGYTMHGLTGRLLGPAS
ASSATLEDCNQPDAEEPDQSEPEADTEPLMAAWPSPGQSECCKSGAYKERGRLPQDPVSE
DDDSASEGSGDKITFNVNLNSVFVRIPDDDSEVPPTSPPFLEETANLEDSDETEISFLAA
SGEGTQPPFASPSAECPWPEDALSDKSDSSESDADIRDGYIMR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgctttggagccagaatacttcctggattagaccccatgatttgtatcccgtggtgtat
ctcgtggtgtgtatcggcctcatggttggtgtggtatcggcatggcctgatttgtcagac
gaatcttgtactttaaaggtgacatttcgcagcttccggcttatcttgtcatgggaatta
aaaaaccattcgattgcaccaactcactatacgttatggtacacagtcatgagtaaacca
gacgatatgaagatcgtggagcactgttcaaatatcacagcatcattttgcgacctaacc
gacgtgtgggaagtcctgccagagacatacatccccagagttgatggattcaggggaaac
acaatgctggtcagctgtatcagcgatttcttcctggcaacacacgtgtctttggaacca
cccgactttgatattgttggctctaccaaccacatcaacgtaatagtgaaatttccacca
gtcattcccaagatactaaatggcgagctcttacagtattacttaccgctcgtcatcgaa
gaacagtcagggaagattgttaagaagcatcaccccaagctaaatggaaacatcattgga
aatgtcacttatgtcatcgacaagctgattccaaacacaaactactgtgtatctgtctat
tttaagtctaaagatatgggagcaataaatagatctccagtcaaatgtaccttccttcaa
cctggacaggaaacagagtcatcagaatccgccaaaataggaggaataattattatgttt
ttaatagcagctgtcttcataagcaccatattaatactgaaacgggttggttatatatgc
ttaagaaatgatttccccaaagttttgaattttaataacttgtcatcctgggtctttctc
gagaggccacccttggaaacagtggctttcgtggaggtgattcacgttaacaggaagaag
aaagtgtgggattataattacgacgatgagagcgacagcaatgatgaggtggcccctcca
ataagcggaggtggttatactatgcacgggctaacgggcaggcttctgggtccggcctcc
gcctcctcggccaccttggaagactgcaaccaaccggacgctgaggaacccgatcaatcc
gaacctgaggctgacaccgagcccctgatggcagcatggcccagccccgggcagtcggaa
tgctgcaagagtggggcctacaaggagagagggaggctgccacaggaccccgtctccgag
gatgatgacagcgccagcgaggggtctggggacaaaattaccttcaatgtaaatttaaac
tctgtgtttgtgaggatccccgatgacgactcagaagtacccccgacgtcaccacctttt
ctagaagagacagccaacctagaggattcagatgaaacagaaataagctttctggcagcc
agtggggaaggaacacagccacccttcgccagcccctctgcagagtgcccgtggcctgaa
gacgctctttctgacaaaagtgacagttctgaatcagatgcggacatcagggatggttat
ataatgagatga

KEGG   Felis catus (domestic cat): 101090765
Entry
101090765         CDS       T02385                                 
Symbol
PDGFRA
Name
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  JAK-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090765 (PDGFRA)
   04014 Ras signaling pathway
    101090765 (PDGFRA)
   04015 Rap1 signaling pathway
    101090765 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101090765 (PDGFRA)
   04020 Calcium signaling pathway
    101090765 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101090765 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101090765 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090765 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090765 (PDGFRA)
   04540 Gap junction
    101090765 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101090765 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090765 (PDGFRA)
   05206 MicroRNAs in cancer
    101090765 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101090765 (PDGFRA)
   05231 Choline metabolism in cancer
    101090765 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101090765 (PDGFRA)
   05218 Melanoma
    101090765 (PDGFRA)
   05215 Prostate cancer
    101090765 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090765 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101090765 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090765 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101090765 (PDGFRA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101090765 (PDGFRA)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101090765 (PDGFRA)
CD molecules [BR:fca04090]
 Proteins
  101090765 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like DUF6232
Other DBs
NCBI-GeneID: 101090765
NCBI-ProteinID: XP_003985426
Ensembl: ENSFCAG00000009141
UniProt: M3WAV8
LinkDB
Position
B1:complement(164394168..164446058)
AA seq 1089 aa
MGTSHLALLVLVCLLTGPSLISCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEVRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTDENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPKTPVTLRSSDGVVHASYDSRQGFNG
TFSVGPYICEATVSGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEVRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTVLANNISNIITEVHRRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSTSDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKNGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKHEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccacctggcgctcctggtgttagtctgtctcctcacaggaccgagccta
atctcctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtgcag
ctgaattcctccttttctctgcgatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaagtcagaaatgaagaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcaatgcgtcggcggcccacacgggactgtacacttgc
tattacaaccacactcagacggacgaaaacgagatcgaaggcaggcgcatttacatctat
gtcccagacccagacgtagccttcgtacctctaggaatgacagattatttagttatcgtg
gaggacgatgactctgccatcataccttgtcgcacaactgatcccaagactccggttacc
ttacgcagcagtgacggggtggtacacgcctcctatgacagcagacagggctttaatggg
accttcagcgtcgggccctatatctgcgaagccacagtcagcgggaagaagttccagacc
atcccatttaatgtttacgctttaaaagcaacatcagaacttgatcttgaaatggaagct
ctcaaaactgtctataagtcaggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacgatg
ctggaggagatcaaggtcccgtccatcaaactggtttacactctgacggtccccgaggcc
acggtgaaggatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttccgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaggctgtcgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccgcctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccaccgacatagaaaagatccaggaagtaaggtatcgaagcaaattaaag
ctgatccgtgcgaaggaagaagacagtggccattacactattgtcgtccaaaatgaagac
gacgtgaagagctatactttcgaactcttaacgcaagttccttcgtctattctggacttg
gtcgacgaccaccatggctccaccgggggacagactgtgagatgcacagcagaagggaca
cctcttcccgatatcgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacggttttggcgaacaacatctcgaacatcatcacggaggtccaccgccgggac
aggagtactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgcctggccaagaatcttcttggagccgagaaccgagagctgaagctggtagctcccacg
ctgcgttctgaactcacagtggcggctgcagtcctggtcctgctggtgattgtgatcatc
tccctcattgtcctggtcgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcgatcagccccgatggacatgaatatatttacgtggacccgatgcagctg
ccttatgactctagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggtgcgttcgggaaagtggtcgaaggaactgcctatggattgagccggtcccagcct
gtcatgaaagtagcagtaaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccccatttaaacattgtgaacttg
ctgggggcctgcaccaagtcaggccctatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgacacccagagaag
ccaaagaaagagttggacatttttgggctgaaccctgctgatgaaagcacacggagttac
gttattttatcttttgaaaacaatggtgactatatggacatgaagcaagcggataccaca
cagtacgtccccatgctggaaaggaaagaggtttctaaatactcggacatccagagatcg
ctgtatgatcgcccggcctcgtataagaagaaatctacgtcagactcggaagtcaaaaac
ctcctctcggacgataactcagaaggcctgactctgctggatttgttgagctttacctat
caagtggcgcgagggatggaatttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctggcc
agggacatcatgcacgattcaaactacgtgtccaaaggcagcacctttctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcaccccgtaccctggcatgatg
gtggattccactttctacaacaagatcaagaacgggtaccggatggccaagcctgaccac
gccaccagcgaagtctatgaaatcatggtcaagtgctggcacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgttgccgggacaatataagaag
agctacgaaaagattcacctggacttcttgaagagcgaccaccctgccgtggcgcgcatg
cgcgtggactcggacaacgcctacatcggcgtcacctacaaacacgaggaagacaagctg
aaggactgggaaggcagcctggacgagcagaggctgagtgcagacagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctcagaagagagcgccattgagacaggttccagcagctctaccttcgtc
aagagagaggatgaaaccatcgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

KEGG   Felis catus (domestic cat): 101091351
Entry
101091351         CDS       T02385                                 
Symbol
IL13RA1
Name
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101091351 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091351 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091351 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101091351 (IL13RA1)
   04090 CD molecules [BR:fca04090]
    101091351 (IL13RA1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101091351 (IL13RA1)
CD molecules [BR:fca04090]
 Proteins
  101091351 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 LIFR_N EpoR_lig-bind LIFR_D2
Other DBs
NCBI-GeneID: 101091351
NCBI-ProteinID: XP_023104651
Ensembl: ENSFCAG00000027640
LinkDB
Position
X:99469068..99526169
AA seq 427 aa
MERPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWDPPEGASP
NCTLRYFSHFDNKQDKKIAPETHRSKEVPLNERICLQVGSQCSTNESDNPSILVEKCTPP
PEGDPESAVTELQCVWHNLSYMKCTWLPGRNTSPDTNYTLYYWHSSLGKILQCENIYREG
QHIGCSFALTNLKDSSFEQHSVQIVVKDNAGKIRPSFNIVPLTSHVKPDPPHIKRLFFQN
GNLYVQWKNPQNFYSRCLSYQVEVNNSQTETHDIFYVEEAKCQNSEFEGNLEGTICFMVP
GILPDTLNTVRIRVRTNKLCYEDDRLWSNWSQAMSIGENTDPTFYITMLLATPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDSLHWKKYDIYEKQTKEETDSVVLIE
NLKRASQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagcggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcggc
ggcggcggcgggggcgccgcgcccaccgaaactcagccgcctgtgacaaatttgagcgtt
tctgttgaaaacctctgcacggtcatctggacatgggaccctcctgagggagccagcccg
aattgcaccttacggtattttagtcattttgacaacaaacaggataagaaaattgctcct
gaaacccatcgttcaaaagaagtgcccctgaacgagaggatttgtctgcaagtgggatcc
cagtgtagcaccaatgaaagtgacaatcctagcattttggtggaaaaatgcaccccgccc
cctgaaggtgatcctgagtctgctgtgaccgagctgcagtgcgtttggcacaacctgagc
tacatgaagtgtacttggctccctggaaggaacacaagtcccgacaccaactatactctc
tactactggcacagcagcctgggaaaaattcttcaatgtgaaaacatctatagagaaggt
caacacattggttgttcctttgctttgactaatttgaaggattccagttttgaacaacac
agcgtccaaatagtggtcaaggataatgcggggaaaattagaccatccttcaatatagtg
cctttaacttctcatgtgaaacctgatcccccacatattaaacggctcttcttccaaaat
ggtaacttgtacgtgcaatggaagaatccacagaatttttatagcagatgcttatcttat
caagtagaagtcaacaacagccaaacagagacgcatgatattttctacgttgaagaagcc
aagtgtcagaattcagaatttgagggaaacctggagggtacaatttgcttcatggtcccc
ggcatcctccccgacactctgaacacagtgagaatccgggtgaggacgaataagctgtgc
tacgaggacgacaggctgtggagcaactggagccaggcgatgagcataggtgagaacacc
gaccccacgttctatataaccatgctgctcgccaccccggtcatcgttgcgggtgccatc
atagtcctcctgctttatctcaaaaggctcaagatcattatattccctccaattcctgat
cctggcaagatttttaaagaaatgtttggagaccagaatgatgacagcctgcactggaag
aagtacgacatctatgagaagcaaaccaaagaagaaactgactctgttgtgctgatagaa
aacctgaagagagcctctcagtga

KEGG   Felis catus (domestic cat): 101091636
Entry
101091636         CDS       T02385                                 
Symbol
CSF2RB
Name
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04210  Apoptosis
fca04630  JAK-STAT signaling pathway
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101091636 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091636 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101091636 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091636 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101091636 (CSF2RB)
   04090 CD molecules [BR:fca04090]
    101091636 (CSF2RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101091636 (CSF2RB)
CD molecules [BR:fca04090]
 Proteins
  101091636 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N fn3 EpoR_lig-bind IL2RB_N1 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101091636
NCBI-ProteinID: XP_011282502
Ensembl: ENSFCAG00000025665
LinkDB
Position
B4:133199512..133223443
AA seq 889 aa
MVLTWGLLPVALLALFWGPGVAGAQETIPLQTLQCYNDYHSHITCRWADTQDAQKFINLT
LFRRLNENPPVPVSCDLSNDTGLSLDHPCAGCVPRRCVIPYKIFVLADKDYFSFRPDRPL
GAQLTVTLDQNVQAPAPKDLQITAVGDRFLLTWRVAPPGSQSHWLSNLEYEVVYKRLQDS
WEDAPTLYCNSSQAVLGPEHLLPSSTYVARVRAHLAPSSGLSGRPSQWSLEVLWHSQTGD
KAQPQNLQCLFDGAAVLSCSWEVWSEVASSVSFTLFYKPSASAREEECSPVLKEQLPGLL
VQHRCQIPVPDPRNHSQYAISVRVKEEEKFIKSSDHIQMAPPTLNVTKSRDGYALSWTTE
EMLYKHIGHTFQIQYKKDADSWKESKTETLQNSHVMSLPLLEPFTRYQARVRVRPTPSGY
NGVWSQWSEETFWDTEWVLPTWVLALILVFTTLALLPVLRFCGIYGYRLNRKWEEKIPNP
SKSHLFQNGSAGLGLPGSMAVLTIRSPLHKGPRGSYFPEMEGVFPADCRHSEVSPLTTED
PKDVHRSPCEPDTASATSDPCTERPPSPHPGPSAPAGKPESRVSGFDFNGPYLGLPRSHS
LPDVTGPPEPPQRGVSQKPQPPGSLEYLCLPAGGQVQLVPLAQVMAQGRAKDLERNPGPE
AEGNPSPESGAGLASPVYRLMVDGQGPKDRALTALPTGSGDPEDGVTASGYVTTADLALP
WPPGLPSASKVHPLDLPSDRNHGLSLGPARRLCSVPAPTKPEIEGYVDIPLTPGQPPKSP
LGSPAPPAASSPILSPGEVAPSPPHPEGLLVLQQVGDYCFLPGLGPGLLSPSSPGPCPEI
GDHDHMFQAKKAPRPAIPQVPAVRHFKALKQQDYLSLPPWDVSRPAEVC
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggtgctgacctgggggctcctccctgttgccttgctggctctgttctgggggcccggc
gtggcgggggcccaagagaccatcccactgcagaccctacagtgttataatgactaccac
agccacatcacctgcaggtgggcagacactcaggatgcccagaagttcatcaacctgact
ctcttccggaggctgaatgagaaccctccagtgccagtgtcctgtgatctcagtaatgac
acgggcttgtcgttggaccacccctgtgccggctgcgtgcccagaagatgtgtcattcct
tacaagatttttgtcctcgccgacaaagactacttctcattccgaccagacaggcctctg
ggcgcccagctcaccgtgactctggaccagaatgtgcaggcccctgcacccaaggacctc
cagatcaccgctgtcggggaccgtttcctgctgacctggagggtggcccctccgggttcc
cagagccactggctgtcaaacctggagtacgaggtggtctacaagcggcttcaggactcc
tgggaggatgcccctaccctctactgcaactcctcccaggctgtcctggggccagagcac
ctccttcccagcagcacctatgtggcccgagtgcgcgcccacctggcccccagctcaggg
ctctcggggcggcccagccagtggagcctggaggttctctggcactcccagacaggggac
aaggcccagccccagaacctccagtgcttgtttgatggggccgccgtgctcagctgctcc
tgggaagtgtggtccgaggtggccagctcagtctccttcaccctcttctacaagcccagt
gccagtgcaagggaggaggagtgctccccggtgctgaaggaacagctccccggcctcttg
gtccagcaccgatgccagattcccgtgcctgaccccaggaaccacagccagtacgccatc
tctgttcgggtgaaggaggaggagaagtttataaagagctcagaccacatccagatggct
cccccgaccctcaatgtgaccaagagcagagacggctacgccctgtcctggacaacagag
gagatgctttacaaacacataggtcacaccttccagatccagtacaagaaagacgcagac
tcatggaaggagagcaagacggagaccctccagaactcccacgtcatgtcactgccactg
ctggagcccttcaccaggtaccaggcgagagtgagggtcaggcccacccccagcggctac
aacggggtctggagccagtggagtgaggagaccttctgggacaccgagtgggtcctgccc
acgtgggtcctggctctcatcctggtgttcaccacgctggccttgctccctgtcctgcgc
ttctgtggcatctatgggtacaggctgaaccggaagtgggaggagaaaatcccaaacccc
agcaagagccacctgttccagaacgggagtgccggactcgggctcccaggcagcatggcg
gtactcaccatcaggagccccttgcacaaggggccgagaggcagctacttccctgaaatg
gagggggtgtttcccgcggactgcaggcacagcgaagtgtcacctctcaccacagaggac
ccgaaagatgtgcacagatcaccatgcgagcctgacacagcttcagccacttcggacccg
tgcacggagcggccccccagcccccatccaggcccgtcggcccccgcgggcaagcccgag
agccgggtctccggctttgacttcaacggcccctacctgggcctaccccgcagccactcc
ctgcctgacgtgacgggccccccggagcccccacagaggggcgtgagccagaagccacag
cctccggggtccctggagtacctgtgtctgcccgcgggaggacaggtgcagctggttcca
ctggcccaggtgatggcacagggccgggccaaggatttggagaggaaccccggcccggag
gccgaagggaacccctcaccggagtcaggggcaggccttgcctctcctgtatacaggctg
atggtggacggtcagggcccaaaggacagggccctcacggctctgcccactggctctggg
gaccctgaggacggcgtcacggcctctggctacgtcaccaccgcagacctggcacttccc
tggcccccggggctgccatctgcctccaaggtccaccccctggacctgccctcagaccgg
aaccacggcctcagtcttggaccggcccgtaggctctgtagcgtcccagcccccacgaag
ccagaaatcgagggctatgtggacatccctctgaccccaggccagccccccaagtcccct
ctgggcagtcctgcccctcctgcagccagcagccccatcctgagcccaggggaggtggcc
cccagccccccacaccccgaggggctcctggtcctgcagcaagtgggcgactactgcttc
ctgcctggcctgggacctggccttctctcaccctcttccccaggaccctgtcctgagatc
ggggaccacgaccacatgttccaggccaagaaggccccgcgccccgccattccccaggtg
ccggccgtcaggcatttcaaagccctaaaacagcaggactacttgtcgctgcccccctgg
gatgtcagcaggcctgcggaggtgtgctga

KEGG   Felis catus (domestic cat): 101092286
Entry
101092286         CDS       T02385                                 
Symbol
IFNGR2
Name
(RefSeq) interferon gamma receptor 2 isoform X1
  KO
K05133  interferon gamma receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04066  HIF-1 signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092286 (IFNGR2)
   04066 HIF-1 signaling pathway
    101092286 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092286 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092286 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101092286 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    101092286 (IFNGR2)
   04659 Th17 cell differentiation
    101092286 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101092286 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092286 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101092286 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    101092286 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    101092286 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101092286 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101092286 (IFNGR2)
   05140 Leishmaniasis
    101092286 (IFNGR2)
   05142 Chagas disease
    101092286 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101092286 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092286 (IFNGR2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101092286 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 101092286
NCBI-ProteinID: XP_006935986
LinkDB
Position
C2:complement(11921768..11949358)
AA seq 352 aa
MRPPPLLPPLSLLLLLFGGRGAAAPSADSLSQLPAPRNPKVRLYNAERVLSWEPVSLSND
TRPVVYQVQHKYRSGSTWFDLGDKGEVNCMNITTTECDFTPKGNSVFPRLEFDTFLRVRA
KVDDLVSPWLTVPSFRYCRNVTVGPPENIWVTPGEGSLIIRLSSPFDVRAFSATFLYYVH
YWEKAGIQQVKGPFRSTSIVLNDLKPLREYCLQVKAQLVCEKGNISRPGHLSNVSCYKTA
MDAATKVQQIIVIAVGLFLFLSMLAGACFFLVLKYRGLVKYWFHSPPSIPLQIEEYLKDP
AQPILEALDKDSSPKDDAWDSVSVVSFPEKEQEDVLQSTLHQSPGPVQQPVG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgcggccgccgccgctcctgccgccgctgtcgctgctgctgctgctgttcggcggccgc
ggcgccgcggcgccctccgcagactctctttcccagctgcctgctcctcgaaacccgaag
gttcgcctgtacaatgccgagcgggttctgagttgggagccggtgtccctgagcaatgac
acgaggccggtggtctaccaggtgcagcataaataccgtagtggcagtacgtggtttgac
ctcggcgacaagggggaggtaaactgtatgaacatcaccacaacagagtgtgacttcacc
ccaaaaggcaactcagtctttccgcgactggaatttgacacctttttacgtgttcgagcg
aaggtagacgacctggtttctccatggctgacagtgccttctttccggtactgtaggaat
gttaccgtcgggcctcccgaaaacatttgggtgacgccaggagaaggctcccttatcatc
aggctctcctctccctttgacgtccgtgccttctcggccacttttttgtattatgtccat
tactgggaaaaggcaggaatccaacaggttaaaggccccttcaggagcacctccatcgtg
ctgaatgatttgaaacccttaagagaatactgtttacaagtcaaagcgcaactggtttgt
gaaaaagggaacatctctagacccggacacttaagcaacgtatcttgctacaaaacagcg
atggatgccgccacaaaagtccagcaaatcatcgtgattgctgtgggactctttctgttc
ctgtcgatgctggcgggggcctgtttcttcctggtcctgaaatacagaggcctggtgaaa
tactggtttcactctccaccgagcatcccgttacaaatagaagagtatttaaaggacccg
gctcagcctatcttggaggccctggacaaggacagctcgccaaaggacgatgcctgggac
tctgtgtccgttgtttcgtttccagagaaggagcaagaagatgttctccagagtactttg
caccaaagccccggtccagtccagcagcctgtgggatga

KEGG   Felis catus (domestic cat): 101092535
Entry
101092535         CDS       T02385                                 
Symbol
IFNAR1
Name
(RefSeq) interferon alpha/beta receptor 1
  KO
K05130  interferon receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092535 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    101092535 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092535 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101092535 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101092535 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    101092535 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    101092535 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101092535 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092535 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101092535 (IFNAR1)
   05160 Hepatitis C
    101092535 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    101092535 (IFNAR1)
   05164 Influenza A
    101092535 (IFNAR1)
   05162 Measles
    101092535 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    101092535 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101092535 (IFNAR1)
   05169 Epstein-Barr virus infection
    101092535 (IFNAR1)
   05165 Human papillomavirus infection
    101092535 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092535 (IFNAR1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IFN receptor family
   101092535 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 101092535
NCBI-ProteinID: XP_023094563
Ensembl: ENSFCAG00000024317
LinkDB
Position
C2:complement(12005881..12029202)
AA seq 561 aa
MFSLLGATTLMLVAGAPWTLPAAAGGTNLKSPENVEVHIIDDTFTLRWDGSDPAGGNVTF
SADYQVPRNDTWLKLPGCQSVTSTKCNFSSLKLNVYEKVKLRVRAERGNQTSPWHNVDAF
APFEKAQIGPPKVHLEAEDKAIKINISPPGAKGGVMWALDSSSFTYSLEIWKNSSSAEIK
TKTVYPRDKIYKLSPETTYCLKVKARLLPRKIGAYSPVYCIKTTVENKLPPPENVRIDAV
NDIYVLKWDYASENMTFQAQWLHAYFKKIPGNNSGKWKQMPGCENVKTTQCAIPQNTFQK
GIYLIRVQASDGNTTSVWSKEKRFDAQLQKSVLVPPTINMKPTNEVSLRVFIGAPEESEN
KSVNQHYSLIYEVVFWENTSNAERKTLEKRTDFTFPNLKPLTVYCVKARALTENERWNKS
SVFSDPVCEKTIPGSTSKTWLIAGICAALLSIPVVTYVLKLFLRCVRYVFFPSSKPPSTI
DEYFSEPPLRNLLLFTSEEQTERCFIIENTNIITTVEETEQIGEDHKKYNSQTSQDSGNY
SNEDDSNDSKSGEDFPQQEAE
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgttctccctcctgggcgcgacgaccctgatgctggttgctggagcgccgtggactttg
cccgcagccgcagggggaacaaatctaaaatctcctgaaaatgtagaggtccacatcatt
gatgataccttcaccctgaggtgggatgggagcgatccagctggcgggaacgtgactttc
tcagcagattatcaagtacccagaaatgatacttggctaaaattgcctgggtgtcaatct
gttaccagcaccaaatgcaacttttcttcgctcaagctaaatgtttacgaaaaagtcaaa
ttgcgtgtaagagcagaaagaggaaaccagacttctccatggcataacgttgacgcattc
gccccatttgaaaaagctcaaattggtcctccaaaagtacatttagaagccgaagataag
gcaataaaaataaacatctccccacctggagcaaaaggtggtgtcatgtgggccctggat
agttcgagttttacatacagcttagagatctggaaaaactcttcaagtgccgaaataaag
actaaaactgtttatcccagagacaaaatttataaactctcaccagagacgacttactgt
ttaaaagttaaagcaagacttttgccgagaaaaatcggtgcctatagtccagtgtattgt
ataaagaccacagttgaaaataagctgcctccgccagaaaacgttcgaatcgatgctgta
aatgacatctatgttcttaagtgggattacgcatctgaaaacatgacttttcaagctcag
tggctccatgcctattttaaaaagattcctgggaacaactcaggtaaatggaaacaaatg
ccaggctgtgaaaatgtcaaaactacccagtgtgccattcctcaaaatactttccagaaa
ggaatttaccttatccgtgttcaagcatctgatggaaataccacatctgtttggtctaaa
gaaaaaagatttgatgctcagttacaaaaaagtgtcctcgttcctccaaccattaacatg
aaacccacgaatgaggtttccctgcgggtctttattggcgctccagaagagtctgaaaac
aagtctgtgaaccagcattactcactaatttatgaagttgtattttgggaaaatacttca
aatgctgagagaaaaactctagagaaaagaactgactttacttttcctaacttgaaacca
ctgactgtgtattgtgtcaaagccagagcactcactgagaatgaaaggtggaataaaagc
agcgtttttagtgatcctgtgtgcgagaaaacaataccaggaagtacttccaaaacatgg
ctcatagctgggatttgtgctgccttattgtccatcccggtcgtcacttacgttctgaaa
ctattcctgcgatgtgtccgttatgtgttcttcccatcaagtaaacctccttccacgata
gatgagtatttctctgagccgccactccggaacctcctccttttcacttctgaagagcaa
actgaaaggtgtttcataatcgaaaatacaaacattatcaccacagtagaagaaactgag
caaatcggtgaagatcacaaaaaatacaattcccaaaccagtcaagattcgggaaattac
tcgaacgaagacgacagcaacgacagcaaaagcggtgaagacttcccgcagcaggaagcc
gagtga

KEGG   Felis catus (domestic cat): 101092622
Entry
101092622         CDS       T02385                                 
Symbol
IL2RB
Name
(RefSeq) interleukin-2 receptor subunit beta isoform X1
  KO
K05069  interleukin 2 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092622 (IL2RB)
   04151 PI3K-Akt signaling pathway
    101092622 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101092622 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101092622 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101092622 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101092622 (IL2RB)
   04659 Th17 cell differentiation
    101092622 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092622 (IL2RB)
   05202 Transcriptional misregulation in cancer
    101092622 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092622 (IL2RB)
   05162 Measles
    101092622 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101092622 (IL2RB)
   04090 CD molecules [BR:fca04090]
    101092622 (IL2RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101092622 (IL2RB)
CD molecules [BR:fca04090]
 Proteins
  101092622 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 101092622
NCBI-ProteinID: XP_023113240
Ensembl: ENSFCAG00000008405
LinkDB
Position
B4:complement(133367536..133382547)
AA seq 551 aa
MDVMAAPGLPWCLSLLVLFLPLAIPRASTAVNDPSKLACFYNSKANISCVWSWDGDLQAT
SCRIHAKPDQRSWNKSCELLPMGSASWACYLILGSPDTQSLTSADTVDMRVMCHEGGRWR
VLMTQKFKPFENLRLMAPDSLQVTHVGTHRCNITWKVRQSSHYIERYLEFEARKRSPGHS
WEEASLLTLAQNQQWISLETLTPDTLYELQVRVRPQLGKNEAWSPWSQPLAFRTRPAAPG
KEAVPFPWLGHIIMGISSAFGFIISVYLLANCRYIGPWLKKVLKCHIPDPSEFFSQLKSV
HGGDFQQKWLSSPFPSSSFSPNTPAPEISPLEVLDRDAKATQLLLLQQEKVPSSSSAETS
GHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPCTEEPDEAGPGAPAGSLLPPLLPPP
GEEDAYCTFLLGGPGPPNTAPGGTGAHDKKLAPSLQEGAPRDWAPRPPLSPPPGAPEPVD
IQPPLEGSVEGAREEGPGPGPGPGEGVRVSFPWASPPGQGQLRAPASCLTLNTDAYLSLQ
ELQDQDPARSG
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggatgtgatggcggctcctggtctgccctggtgtctgtccctccttgtcctcttcctg
cccctggccatccctcgggcatccacagcggtgaacgacccctccaagctcgcgtgtttc
tacaactcaaaagccaacatctcctgtgtctggagctgggatggggacctacaggccaca
tcctgcaggatccacgctaagccggatcaacggtcttggaacaaatcctgtgagctgctt
ccgatgggatcggcctcctgggcctgttacctgatccttggatccccagatactcagagt
ctgacttcggctgacaccgtggacatgagggtgatgtgccacgaaggggggaggtggagg
gtgctgatgacccagaaattcaagccctttgagaaccttcgcctgatggcccccgactcc
ctccaagtcactcacgtagggacccacagatgcaacataacctggaaagtccgccagtcc
tcccactacattgaaagatacctggagtttgaggcccggaaaaggtccccaggccacagc
tgggaggaggcctccctgctgaccctcgcgcagaaccagcaatggatttccctggagacc
ctcactccagacaccctgtatgaacttcaagtgcgggtcaggccccagctgggcaaaaac
gaggcttggagcccctggagccagcccctggccttcaggacgaggcccgcagccccaggg
aaggaggctgtgccctttccttggctgggccacatcatcatgggcatcagcagtgccttt
ggcttcatcatctcggtctacttgctggccaactgccggtacatcgggccatggctgaag
aaagttctgaaatgtcacatcccagatccctcagaattcttctcccagctgaagtcagtg
catggaggagatttccagcagaagtggctctcctctcccttcccctcgtcgtccttcagc
cccaacacgccggcccccgagatctccccgctggaggtgctggacagggacgccaaggcc
acacagttgctcctgctacagcaggagaaggtgccctcctcgtcctcagccgagaccagc
ggccactcgctgaccagctgcttcaccaatcagggctatttcttcttccacctcccggac
gctctggagatcgaggcctgccaggtgtacttcacctatgacccctgcacggaagagccc
gatgaggccgggcccggggcgcctgcggggtctctcctgccacccctgctgcctccgccc
ggggaggaagacgcctactgcaccttcctcctcggcggcccgggccccccaaacacggcc
ccggggggcactggagctcatgacaagaagctggccccctccctgcaggagggagctccc
agagactgggccccccggcccccgctgtctcccccgccaggtgcacctgagccggtggac
atccagccacccctggagggctccgtggaaggagcaagggaggagggcccgggcccgggc
cctggccctggggagggggtcagggtcagcttcccctgggccagccctcctgggcaaggc
cagctcagagcccctgcctcctgcctgaccctgaacaccgatgcctacctgtccctccag
gagctgcaggatcaggacccagctcgctcggggtag

KEGG   Felis catus (domestic cat): 101093085
Entry
101093085         CDS       T02385                                 
Symbol
IL12RB1
Name
(RefSeq) LOW QUALITY PROTEIN: interleukin-12 receptor subunit beta-1
  KO
K05063  interleukin 12 receptor beta-1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101093085 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101093085 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101093085 (IL12RB1)
   04659 Th17 cell differentiation
    101093085 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093085 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101093085 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101093085 (IL12RB1)
   04090 CD molecules [BR:fca04090]
    101093085 (IL12RB1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101093085 (IL12RB1)
CD molecules [BR:fca04090]
 Proteins
  101093085 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N fn3_2 DUF905
Other DBs
NCBI-GeneID: 101093085
NCBI-ProteinID: XP_023096976
Ensembl: ENSFCAG00000007522
LinkDB
Position
A2:complement(13332229..13351490)
AA seq 687 aa
MDFMGQLLTRLVPLLLLLLPAQGAEACGTSGCCFQDPPYPDADSGSASGPKDLTCYRIFS
AGYECSWRYEGPAAGVSHFLRCCLRSGRCCYFAAGSATKVQFSDQDGISVLQAVTLWVES
RAGNRTEKSPKVTLMLHSSGQYPVLLLLLPAAPSSPREASDWEHLEGHCGRQDDAGFESC
LCPLQMDAAQEFQLRRRRLRPGAPGDPWSSWSSPVCVPPERLPQPSWRFSVGALRPDGKR
QVTLDGQLPQLELPEGCLRSKSGGEVTYRVHLHMLSCPCKPKATKTLQLRRFINISGAAY
DLAVVSQNRFGPGPNQTWHIPAHAHTHPGVLNISAGANGTIMRWPAWAPDMTYCIEWQPR
GQDRSLTTCTLIPPQDRDPTGMATYSWSRASGALEQKMCYRITIFASANPQKPTSWSTVL
STYHFGGHAPGAGSPQHVLVKRLSQDSVTVEWAPSVLSACPGVLKEYVVLCREKDGGQMS
KLSVKPTETEVTLGGLRAGTAYTVQVRADTVTLQGAWSQPQPFSFEVQVSQFDLSVLLAS
LGSFLSILLLGVLGYLGLNRAARYLCPPLPTPCASTVVEFHSSQGKQAWQWTSPADFPEE
VYRKEALVVNVSWEKGEGTDLDTPGHLKEKTRLLQGTPELALDAELPSEDGDRCEDTLRL
RLRSPEGRMVWRAALPRRLDSHCSWET
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggacttcatggggcagttgttgaccaggctggtccccctccttctgctcctgcttcca
gcgcagggcgccgaagcctgcggcacgagcgggtgctgttttcaggacccaccgtatccg
gatgcagactcagggtcggcttcaggccccaaggacctgacctgctaccggatattcagc
gccggttatgaatgctcctggcggtacgagggccccgcggctggggtcagccacttcctg
aggtgctgcctcaggtccgggcgctgttgctactttgccgcgggctcggccaccaaggtg
cagttctccgaccaggacggcatatctgtgctgcaggccgtcaccctctgggtcgaatct
cgagccgggaaccggacagagaagtcacccaaggtcaccctgatgcttcatagctcaggt
cagtaccctgttctcctcctcctcctccccgcggccccttcgtcacccagagaagcctcc
gactgggagcatcttgagggccactgtggacgtcaggatgatgctggcttcgagtcatgc
ctctgccccctgcagatggacgcagcccaggaattccagctgcggaggcggcggctcagg
ccgggagccccaggagatccctggagcagctggagcagccccgtgtgtgtcccgcctgaa
cgtctcccacagcccagctggaggttctcggtgggggcactccgcccagacgggaagagg
caggtgactctggatgggcagctgccccagcttgagcttccagaaggctgcctcaggtcc
aagtctggcggggaggtgacctaccgtgtccacctgcacatgctgtcctgcccgtgtaag
cccaaggccacaaagaccttgcagctgagaaggttcatcaatatctccggcgccgcctat
gacctggctgtcgtctcccagaatcgctttggccccggccccaaccagacgtggcacatt
cctgcccatgcccacacccacccaggggttctgaatatcagcgccggcgccaacgggacc
atcatgcgttggccagcctgggccccggacatgacctactgcatcgagtggcagccccgg
ggccaggacaggagcctgaccacctgcaccctgattccaccccaggatcgggaccctact
ggaatggcaacctacagctggagcagggcatccggggcgctggagcagaagatgtgttac
cgcatcacgatcttcgcgtccgcaaacccacagaagcccacctcgtggtccacggtcttg
tccacctaccacttcggaggccacgccccgggggctggaagcccacaacacgtgctggtg
aaaaggctcagccaggactccgtgacggtggagtgggcgccctccgtgctgagcgcctgc
cctggcgtcctgaaggagtacgtcgtgctctgccgggagaaggatggaggccagatgtcc
aagctgtctgtgaagcccacggagaccgaggtcacccttggtggccttcgggctggcaca
gcctataccgtgcaggttcgagcagacacagtgacgctgcagggcgcctggagccaaccc
cagccattcagcttcgaagtccaggtttcccagttcgatttgtccgtactcctcgcgtct
ctggggagcttcctgagcatccttctcctgggcgtccttgggtacctcggcctgaacagg
gctgcgcggtatctgtgcccgcccctgcccacaccctgtgccagcactgtggtcgagttc
catagcagccaggggaagcaggcttggcagtggacaagcccggcagacttcccagaggag
gtgtaccgaaaagaggccctggtggtgaacgtgtcctgggaaaaaggtgagggaacggac
ctggacacgcccgggcatctcaaggagaagacacggctgcttcagggcactcctgagctg
gccttggacgcggagctgccctcggaggacggagacaggtgcgaggacaccctgaggctc
agactccggagcccggaaggcaggatggtctggagggcagccctgcccaggcggctggac
tcccactgctcttgggagacctaa

KEGG   Felis catus (domestic cat): 101093244
Entry
101093244         CDS       T02385                                 
Symbol
GHR
Name
(RefSeq) growth hormone receptor isoform X1
  KO
K05080  growth hormone receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04080  Neuroactive ligand-receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101093244 (GHR)
   04151 PI3K-Akt signaling pathway
    101093244 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101093244 (GHR)
   04060 Cytokine-cytokine receptor interaction
    101093244 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101093244 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101093244 (GHR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101093244 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 DUF4605
Other DBs
NCBI-GeneID: 101093244
NCBI-ProteinID: XP_011284650
Ensembl: ENSFCAG00000026499
LinkDB
Position
A1:complement(207381451..207654500)
AA seq 645 aa
MIADPTGMDLWQLLLTLAVAGSSSAFSGSEATPAILGRASQSLQRVNPGLGTNSSGKPKF
TKCRSPELETFSCHWTDGVRRGFKSPGSTQLFYIRRSTQEWTQEWKECPDYVSAGENSCY
FNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQV
RWEPPPNADVQKGWIVLEYELQYKEVNESQWKTMDPVLSTSVPVYSLRLDKEYEVRVRSR
QRNSEKYGEFSEVLYVTLPQMSPFACEEDFQFPWFLITIFGIFGLTMILFLFIFSKQQRI
KMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKPEFYNDDSWVEFIELDIDDP
DEKTEGSDTDRLLSNDHEKSLNILGAKDDDSGRTSCYEPDILETDFNASDMCDGTSEVAQ
PQRLKGEVDLLCLDQKNQNNSPSTDATPTTQQPSVILAKENKPRPLLTSGTESTHQAAHT
QLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGISPCDMHPEAVSLCQANFIMDNA
YFCEADAKKCIAVAPHVEAESRVEPNFNQEDIYITTESLTTTAGQSGTAERAPGSEMPVP
DYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgattgcagatcctacaggtatggatctctggcagctgctgttgaccttggcagtggca
ggatcaagcagtgctttctctgggagtgaagccacaccagctatccttggcagagcatcc
cagagtctgcaaagagttaatccaggcctagggacaaattcttctgggaagcctaagttc
accaagtgccgttcacctgaactagagactttttcgtgccactggacagatggggttcgt
cgtggcttcaagagcccaggatccacacagctgttctatattagaaggagcactcaagag
tggactcaagagtggaaagaatgccccgattatgtctctgctggagaaaacagctgttac
tttaattcatcttatacctccatttggataccctactgtatcaagctaaccagcaatggt
ggtacagtggatcaaaagtgtttctctgttgaggaaatagtgcaaccagatccacccatt
ggcctcaactggactctactgaacatcagtttaacggggattcatgccgatatccaggtg
aggtgggaaccaccgcccaatgcagacgttcagaagggatggatagtcctggagtatgaa
ctgcaatacaaagaagtaaatgagtcccagtggaaaacgatggaccctgtattgtcaaca
tcagttccagtttattcactgagactagataaagaatatgaagtgcgtgtgagatccaga
caacgaaactctgaaaaatatggcgagttcagtgaggtgctctatgtaacacttcctcaa
atgagcccatttgcatgtgaagaagatttccagtttccatggttcttaattactatcttt
ggaatatttgggctaacgatgatactatttttattcatattttctaaacagcaaaggatt
aagatgctgattcttcccccagttccagttccaaagattaaaggaattgatccagatctc
ctcaaggaaggaaaattagaagaggtgaacacaatcttagccattcatgacaactataaa
cctgaattctacaacgatgactcttgggttgaattcattgagctggatattgatgacccc
gatgaaaagactgaaggctccgacacagacagacttctaagcaatgaccatgagaaatca
cttaacatccttggagcaaaggatgatgactctggacgtaccagctgttatgaacctgac
attttagagactgatttcaatgccagtgacatgtgtgatggtacctcagaggttgctcag
ccacagaggttaaaaggggaagtagatctcttgtgccttgaccagaagaatcaaaataac
tcaccttctactgatgctacccctaccactcagcagcccagtgttatcctagcaaaggaa
aacaaaccaagaccgcttcttactagtggaactgagtcaactcatcaagctgcccatact
cagctgagcaatccgagttcactggcaaacatcgacttttatgcccaggtaagcgacatt
actccagcagggagtgtggtcctttccccaggccaaaagaataaggcagggatatccccg
tgtgacatgcatccagaagcggtctcactctgccaagcaaacttcatcatggacaacgcc
tacttctgcgaggcagacgccaaaaagtgcatcgctgtggcccctcacgtcgaggctgaa
tcacgtgtggagccaaactttaaccaggaagacatttacatcaccacagaaagccttacc
actaccgctggccagtctgggacagcagaacgggctccgggttctgagatgcctgtccca
gactatacctccattcacatagtacagtctccgcagggcctcgtgctcaatgccacagcc
ttgcccttgcctgacaaagagtttctctcatcgtgtggctacgtgagcacagaccaactg
aacaaaatcatgccgtag

KEGG   Felis catus (domestic cat): 101096026
Entry
101096026         CDS       T02385                                 
Symbol
IL21R
Name
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04659  Th17 cell differentiation
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101096026 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096026 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101096026 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101096026 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101096026 (IL21R)
   04090 CD molecules [BR:fca04090]
    101096026 (IL21R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101096026 (IL21R)
CD molecules [BR:fca04090]
 Proteins
  101096026 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 101096026
NCBI-ProteinID: XP_003998800
Ensembl: ENSFCAG00000009924
UniProt: M3WCD6
LinkDB
Position
E3:complement(22832028..22866595)
AA seq 538 aa
MLCGWAAPLFLLMLQGAWGCLDLVCYTDYFKTVTCTLETWTVHPGTLTLTWQDLYGELVD
EVTSCSLRRSTHNATHTEYTCHMDVFHFMADDIFSVNMTDQSGNRSQECGSFVLAKSIKP
SPPFNVTVTFSEHYNVSWDSNHDSYPLKGKLQHELRYRRQGDPWALSPGRKLVSVDARSV
SLLPLEFRFDSDYEVQVRSGPQPGSSFQGTWSEWSDPVTFHTLPEELKGDGHIYLLYIFL
VIVVIVFLGLKIDLPWRLCKEWIQVPSPEQFFQPLYVSHSGDFRKWVGTPFTASSLELVP
WSPEALSSLETHTGCPPQGASKGPEPTELPEPADLVEADGVPELGFWGPAHSVVSSLGGS
AYSQERDRPYGLVSIDTVTVAGTEGPCAWSCTCGDDGYPALNLDASLEPGSSTGDPLLDI
ETTVLSCGCVSTGGLGGPDSPLGSLLDRLKLPLKDEAGWTPGPPWSGGPPRGVPGSEAGS
PPAGLDMDTFDSGFAGSDCGSPVECDFASPGDAGPPRSYLRQWVVMTPPPEGSGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgctgtgtggctgggcggcccctctgttcctgctgatgctccagggtgcctggggctgc
ctagacctcgtctgctacaccgattacttcaagacagtcacctgcaccctagagacatgg
accgtccaccccggcacgctcacccttacctggcaagacctatacggagaactagtggac
gaggtcacctcctgcagcctccgccggtccacccacaatgccacacacacagagtacacg
tgccacatggatgtgttccacttcatggccgacgacattttcagtgtcaacatgacagat
cagtccggcaatcgctcccaggagtgtggcagctttgtcctggctaagagcatcaagccg
tccccccctttcaatgtgaccgtgaccttctcggaacattataacgtctcctgggactcc
aatcacgattcctatcctctgaagggcaagctacaacatgagctgcggtacaggaggcag
ggagacccctgggcgctgagtccggggagaaagctggtctccgtggacgcgaggagcgtc
tctctccttcccttggagttccgctttgactcggactacgaggtccaggtgcgctcgggg
ccgcagcccggctcttccttccaggggacgtggagcgagtggagtgacccagtcaccttt
cacaccctgccggaagagctaaagggagacggccacatctacctgctgtatatcttcctg
gtcattgtagtcatagtcttcttgggcctgaagatcgacctgccttggaggctgtgtaaa
gagtggatacaggtgcccagcccagagcagttcttccagcccctctacgtgagccacagc
ggagacttcaggaaatgggtgggcacgcccttcactgcctccagcttggagctggtgccc
tggagcccagaggcgctttcgtccctggagacgcacaccggctgcccgccgcagggtgcc
agcaaggggccggagcccacggagctgccggagcccgcggacctggtggaggcggatggg
gtgcccgagctgggcttctggggcccagcccactccgtcgtcagcagcctcggtggctca
gcttacagccaggagagggaccggccatacggcctcgtgtccattgacacggtgaccgtg
gcgggcaccgaggggccctgtgcctggtcctgcacctgtggagatgatggctacccagcc
ctgaacttggacgccagtctggagcctggctcgagcactggggacccgctcttggacata
gagaccacagtcctgtcctgcggctgcgtctcgactggtggccttggcgggccggacagc
cctctgggcagcctcctcgacaggctgaagctgcccctcaaagatgaggcgggttggacc
ccggggccgccctggagcggtgggccaccccgaggggtgcctggaagcgaggcaggctcg
cccccggccggcctagacatggacacttttgacagcggcttcgcgggctctgactgcggg
agccctgtggagtgtgacttcgccagccccggggacgcagggccccccaggagctatctc
cgccagtgggtggtcatgacccctccacctgagggatctgggccgcaggccagctag

KEGG   Felis catus (domestic cat): 101096277
Entry
101096277         CDS       T02385                                 
Symbol
IL4R
Name
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101096277 (IL4R)
   04151 PI3K-Akt signaling pathway
    101096277 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096277 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101096277 (IL4R)
   04658 Th1 and Th2 cell differentiation
    101096277 (IL4R)
   04659 Th17 cell differentiation
    101096277 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096277 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101096277 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101096277 (IL4R)
   04090 CD molecules [BR:fca04090]
    101096277 (IL4R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101096277 (IL4R)
CD molecules [BR:fca04090]
 Proteins
  101096277 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N IL2RB_N1 EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101096277
NCBI-ProteinID: XP_023102076
Ensembl: ENSFCAG00000023022
LinkDB
Position
E3:complement(22898378..22940972)
AA seq 818 aa
MGRLCSGLTFPVSCLILMWAAGSGSVKVLRAPTCFSDYFSTSVCQWNMDAPTNCSAELRL
SYQLNFMGSENRTCVPENGEGAACACSMLMDDFVEADVYQLHLWAGTQLLWSGSFKPSSH
VKPRAPGNLTVHPNVSHTWLLRWSNPYPPENHLHAELTYMVNISSEDDPTDSRIYNVTYM
GPTLRVAASTLTSGASYSARVRAWAQSYNSTWSEWSPSTKWLNHYEPWEQHLPLGVSISC
LVILAVCLSCYLSVIKIKKEWWDQIPNPAHSHLVAIVIQDPQVSLWGKRSRGQEPAKCSH
WKTCLRKLLPCLLEHGMERKEDPSKIARNGPSQGSGKSAWCPVEVSKTILWPESISVVRC
VELLEAPVESEEEEEEEEEDKGSFCPSPVNLEDSFQEGREGIAARLTESLFMDLLGVEKG
GFGPQGSLESWFPPPSGSAGAQMPWAEFPGPGPQEASPQGKEQPFDPRSDPLATLPQSPA
SPTFPETPPVVTDNPAYRSFGTFQGRSSGPGECDSGPELAGRLGEADPGIPAAPQPSEPP
SALQPEAETWEQILRQRVLQHRGAPAPAPGSGYREFVCAVRQGSTQDSRVGDFGPSEEAG
YKAFSSLLTSGAVCPETSGGEAGSGDGGYKPFQSLTPGCPGAPAPVPVPLFTFGLDAEPP
HCPQDSPLPGSSPEPAGKAQDSHKTPPAPEQAADPLRDDLASGIVYSALTCHLCGHLKQC
HGQEEGGEAHPVASPCCGCCCGDRSSPLVSPLRAPDPLPGGVPLEASLSPASPAPLAVSE
EGPPSLCFQPALSHAHSSSQTPKKVAMLSPEPTCTMAS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggggcggctttgctctgggctcacgttccctgtgagctgtctgatcctgatgtgggcg
gcaggctctgggagcgtcaaggtcctgcgtgcgcccacctgcttctccgactacttcagc
acctccgtctgccagtggaacatggatgcgcccacgaactgcagcgctgagctccgcctg
tcctaccagctgaacttcatggggtccgaaaaccgcacgtgtgtccctgagaacggagaa
ggcgcggcgtgtgcgtgcagcatgctgatggacgactttgtcgaagcggacgtgtatcag
ctgcacctgtgggcggggacgcagctgctgtggagcggctccttcaagcccagcagtcac
gtgaaacccagggctcccggaaacctcacggttcaccccaacgtctcccacacgtggctg
ctgaggtggagcaacccttacccccctgagaaccacctgcacgccgagctcacctacatg
gtcaacatctcgagtgaagacgaccccacggattccagaatctataatgtgacctacatg
gggcccaccctccgcgtggcagccagcaccctgacgtctggggcttcctacagcgcacgc
gtgagggcctgggctcagagctacaacagcacctggagcgagtggagccccagcaccaag
tggcttaaccactacgagccctgggagcagcacctcccacttggcgtcagcatctcctgc
cttgtcatcctggccgtctgcctgtcctgctacctcagcgtcatcaagattaagaaagaa
tggtgggaccagattcccaaccccgcccacagccacctagtggcgatagtcatccaggac
ccacaggtgtcgctgtggggaaagcggtcccgaggccaggaaccagccaagtgctcacac
tggaagacttgtcttaggaagctcctgccctgtttactggagcacggcatggaaaggaaa
gaggatccctccaagattgccagaaatgggccttcgcagggttctggaaaatcagcatgg
tgccccgtggaggtcagcaagacgatcctctggcccgagagcatcagcgtggtgcgatgt
gtggagctcctggaggccccggtggagagcgaggaggaggaggaggaggaggaggaagat
aaagggagcttctgcccatcgcctgtgaacctcgaggacagcttccaggagggccgggag
ggcatcgcggcccggctgaccgaaagcctcttcatggaccttctcggggttgagaaaggg
ggctttggcccacagggctcgctggaatcgtggtttcctcctccttcgggaagtgcaggt
gctcagatgccctgggctgagtttccgggtccggggccccaggaggcatcgccccagggc
aaggagcagcctttcgacccccggtccgatcctctggccactctgccccagagcccagcc
agcccgactttcccagagacgcccccggtcgtcacagacaaccccgcctaccgcagcttc
gggaccttccagggccggtcctcaggtcccggcgagtgtgactcgggccccgagctggcg
ggacgcctgggggaggcggaccctggcatccccgctgccccccagccttcggagccgcct
tccgcgctccagcccgaggcagagacctgggagcagattctgcgccagcgagtcctgcag
cacaggggggccccggccccggcccccggcagcggctaccgagagtttgtgtgcgccgtg
aggcagggcagcacccaggacagcagggtgggggacttcggcccctcggaggaggccggg
tacaaggccttctcgagtctgctcactagcggtgccgtctgcccagagacgtccgggggt
gaggccggcagtggggacgggggttacaagcccttccagagcctcactcctggctgccct
ggggcccccgccccagtccccgtccccctgttcaccttcggactggacgcggagccacct
cattgcccgcaggactcccccctcccgggcagctccccagagccagcggggaaggcgcag
gacagccacaagaccccgccggccccggagcaggccgcagaccccctccgggacgacctg
gccagcggcattgtctactcagccctcacctgccacctgtgtggccacctgaagcagtgt
cacggccaggaggagggtggcgaggcccaccccgtggccagcccctgctgcggctgctgc
tgtggagacaggtcctcgccgctggtgagccctctgagggccccggaccccctgccaggt
ggggtgcccctggaggccagcctctctccagcctccccggcacccttggctgtctcagag
gagggcccgccctccctgtgcttccagcctgccctgagccatgctcacagctcaagccag
acccccaaaaaggtggccatgctctccccagagcccacgtgcacgatggcttcctag

KEGG   Felis catus (domestic cat): 101096447
Entry
101096447         CDS       T02385                                 
Symbol
OSMR
Name
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X1
  KO
K05057  oncostatin M receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101096447 (OSMR)
   04151 PI3K-Akt signaling pathway
    101096447 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096447 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101096447 (OSMR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101096447 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 Pur_ac_phosph_N EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 101096447
NCBI-ProteinID: XP_023094731
Ensembl: ENSFCAG00000008082
LinkDB
Position
A1:complement(210526543..210579312)
AA seq 961 aa
MALFSAFQTTFLLALLSLKTYQSEVLSEPLSLAPESLEVSIDSARQCLHLKWSVHNLAYH
QELKMVFQIEISRIKTSNVIWVENYSTTVKRNQVLRWSWESKLPLECAKHSVRMRGAVDD
AQVPELRFWSNWTSWEEVDVQSSLGHDPLFVFPKDKLVEEGSNVTICYVSRSHQNNISCY
LEGVRMHGEQLDPNVCVFHLKNVPFIRETGTNIYCKADQGDVIKGIVLFVSKVFEEPKDF
SCETRDLKTLNCTWAPGSDAGLLTQLSQSYTLFESFSGKKTLCKHKSWCNWQVSPDSQEM
YNFTLTAENYLRKRSVHLLFNLTHRVHPMAPFNVFVKNVSATNATMTWKVHSIGNYSTLL
CQIELDGEGKVIQKQNVSVKVNGKHLMKKLEPSTEYAAQVRCANANHFWKWSEWTRRNFT
TAEAAPSEAPDVWRNVKSVQGHCVVTLFWKPLSKLQANGKILFYNVVLENLDRPSTLKLL
SIPAPANGTELTLDRCSYQIHVTANNSVGTSPASVIAVSGDPGNKEVEEERVKGTEDGFC
LSWKPQPGDVTGYVVEWCERPGDPLCDLQWKNLGPNTTSTVVSSDAFRPGVRYNFRIYGI
STERIPYLLEKKTGYSQELVPSDNPQVLMSNLTSYSFTLSWKDYAAESQPGFVQGYSLYL
KSKAARCLPGSEKAVLSDDSICCKYKIDNPKQKTFVVENLQPASFYEFFLTPYTSVGEGP
QGAFTKVTTPDEYSHILIRIILPMIFSILLIMILCYLKSQWMKEKCYPDIPDPYKSSVLS
LIKSKENPRLTIMNVKDCIPDAIEVINKQEGTRKSLTETEPTKPTYLYLLPTEKSHSGPG
PCICFENFTYNQAASDSVSCGHVPVTPKAQPSQLGLLTSSENVPKALGKNYVNSLGEIPA
GETNLNYVSQLASPMCGDKSSLPTNPPEPALCSEYKTQMAIPMGLASPPSITLLDEGEHD
H
NT seq 2886 nt   +upstreamnt  +downstreamnt
atggctctcttttcagcctttcagacaacattcctcttggcattgctgtccttgaaaact
taccagagtgaagtcttgtctgaacccttgtcattggcccctgaatcactggaagtttcc
atcgattctgcacgtcagtgtttgcatttaaaatggagtgtccacaaccttgcttatcat
caggaattaaaaatggtttttcagatagaaatcagtagaattaaaacatctaatgtcatc
tgggtggagaactatagcaccactgtgaagcggaaccaagttctgcgttggagctgggaa
tccaagcttcctttggaatgtgcaaaacactctgtaagaatgaggggtgcggtggatgac
gcccaggtccccgagctgaggttctggagcaattggacttcgtgggaggaggtagatgta
cagagttctcttggacacgatccattgttcgttttccctaaggataagctggtggaagaa
ggctccaatgtcaccatttgttacgtttctaggagccatcaaaacaacatatcctgttat
ttggaaggcgtacggatgcatggagaacaacttgatccaaacgtctgtgtgttccacttg
aagaacgttcctttcattagagaaactgggacaaatatctattgtaaggcagaccaagga
gacgttataaaaggcatcgttctctttgtatccaaagtatttgaagagcccaaggatttt
tcttgtgaaacccgggacttgaagactttgaactgtacttgggctcccgggagcgacgct
ggcttgctcacacagctttcccaaagctacactttgtttgaatcgttttctgggaaaaag
acactttgtaaacacaaaagctggtgtaactggcaagtatctccagactcccaagaaatg
tacaacttcacactcacagctgaaaactacttaagaaagagaagtgttcatcttcttttc
aacttgactcatcgagttcacccaatggctccctttaacgtatttgtcaaaaatgtaagt
gccacaaatgccaccatgacctggaaggtgcactccattgggaattattccacactattg
tgtcagattgaactcgatggtgaaggaaaagtgatacaaaagcaaaatgtttctgtcaag
gtgaatggtaagcacctcatgaagaaactggagccttccacagagtacgcggcccaagtg
cgctgtgctaatgccaaccacttctggaaatggagtgaatggactcgtcgcaactttacc
acggctgaagctgctccctcagaggctcctgatgtctggaggaatgtgaagtcagtgcag
ggacattgtgtcgtgactttattctggaagccactatcaaaattgcaggccaatgggaag
attctcttctataatgtagttctagaaaatctagacagaccatccaccttgaagctcctc
tccattcctgctccggccaatggcacagaactaaccctcgaccggtgttcttaccaaatc
cacgtcacagctaacaacagtgtgggcacgtcccccgcttcggtcatcgccgtgtccgga
gaccctggaaacaaagaggttgaagaagaaagagtcaagggcacagaggacggattctgt
ctgtcttggaaaccccaacccggagacgtcacgggctacgtcgtggagtggtgtgaacgt
cccggggacccgctctgtgatctccagtggaaaaacctaggtcccaataccacaagcaca
gttgtcagctcagatgcttttagaccaggggttcgatacaacttcagaatttatggaatt
tctacagaaaggattccttatttattagagaaaaaaacgggatactcccaggaattggtg
ccttcagacaaccctcaagtgctcatgagtaacctgacctcctactcctttactctgagc
tggaaggactatgccgccgagtcccagcccggttttgtacaagggtactccctctatctg
aagtccaaggctgcgcggtgcctcccgggatctgaaaaggcagtcctctcagatgattca
atatgttgcaaatacaaaattgacaaccccaaacagaagacatttgtcgtggaaaacctg
cagccggcgtctttctatgagtttttcctcactccatacaccagtgtcggcgagggcccc
cagggcgctttcacaaaggtcacaactccagatgaatactcccatatactgatacgtatc
atactccccatgattttctccattttgctcatcatgatcttatgctacttgaaaagtcaa
tggatgaaggagaagtgttaccctgacattccagatccttacaagagcagcgttctgtca
ttaataaaatccaaggagaacccccgcctaacaataatgaatgtcaaggactgtattcca
gatgctattgaagtcataaacaagcaggaaggcactaggaagtcactgacagaaactgaa
cccaccaagcccacctacctttacctcctcccaacagagaagagccactccgggcctggc
ccctgcatctgttttgagaactttacctataatcaggcggcttctgactccgtttcttgt
ggccacgtcccagtaacccctaaagcccagccaagtcagctgggactgttgacatcatct
gaaaatgtaccgaaggcactaggaaaaaactacgtcaactccctgggagaaataccagct
ggagaaactaatttgaattatgtgtcccagttggcctcacccatgtgtggagacaagtcc
agtctccccacaaatccaccagagccagcactgtgttcagagtacaaaacgcaaatggcc
attcccatgggtctggcctctcctccctcgattaccctcttagatgaaggtgagcacgac
cactaa

KEGG   Felis catus (domestic cat): 101097002
Entry
101097002         CDS       T02385                                 
Symbol
MPL
Name
(RefSeq) thrombopoietin receptor isoform X3
  KO
K05082  thrombopoietin receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101097002 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101097002 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101097002 (MPL)
   04090 CD molecules [BR:fca04090]
    101097002 (MPL)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101097002 (MPL)
CD molecules [BR:fca04090]
 Proteins
  101097002 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N
Other DBs
NCBI-GeneID: 101097002
NCBI-ProteinID: XP_003990020
Ensembl: ENSFCAG00000015112
UniProt: M3WLY7
LinkDB
Position
C1:34191193..34207990
AA seq 680 aa
MPSWALLVVTSCLLLAPQNLAQVSSQDTSLLASDSEPLKCFSQTFEDLTCFWDEEEAAPN
GTYQLLYAYPGEKPRACPLSFENVLPFGTRYVCQFPAQDEVRLFFPLHLWVKNMFLNQTV
TQRVLFVDSVGLPAPPNIIKAVGGSQPGELQISWETPAPEISAFLRHELRYGPKDPRNSS
ALTVMQLLPTETCCPALQRLNPAPALHQPPCAQPMMPQQDRPEQTSPTREASSLTVMSGS
CLISGLQPGKSYKLQLRSQPDGVSLHGSWGSWSLPATVDLPGDAVEIGLQCFTLNLKTVT
CQWQQQNHTSSQGFFYHSRARCCPGNRDPIWEKCEEEKNPGLQPSQFSRCHFKSRNDSVI
HILVEVTTAQGAVHSYLGSPFWIRQAVLIPTPNLHWREVSSGQLELEWQHPSSWGARETC
YQLRYTGEGHQDWKVLEPPLGARGETLELRPRSRYRLQLRARLHGPTYQGPWSAWSDPVS
VDTASETAWISLVTALLVVLGLSTLLGLLLLRWQFPAHYRSLKHALWPSLPDLHRVLAQY
LRDTAALSPPKTAVSDACEEVEPSPLEILPKSSEKTPVALCSSQAQMDYRRLPPSCLGTM
PLSVCPPMAEMGSYCTTHIANHSYLPLSCWQAPLSQYPGQIQTHQTSFPNLPTHSNPTTQ
TSQTSRPSPSVCPHSWAPRH
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcctggtggtcacctcctgcctcctcctggccccccaaaacctg
gcacaagtcagcagccaagatacctccttgctggcctcggattcagagcccctgaaatgt
ttctctcaaacctttgaggacctcacttgcttctgggatgaggaagaagcagcacccaat
ggaacataccagctgctgtatgcttatccaggggagaagccccgtgcctgccctcttagt
tttgagaacgtgctgccctttggaactcgatatgtgtgccagtttccagcccaggatgaa
gttcgcctcttctttccactgcacctctgggtgaagaacatgtttctgaaccagactgtg
acccagcgggtgctctttgtggatagtgtgggcctgccagctcccccaaatatcattaag
gctgtgggcgggagccaaccaggggaacttcagatcagctgggagaccccagctcccgaa
atcagtgctttcctgaggcacgaactccgctatggccccaaggatcccaggaattccagt
gctctcacagtcatgcagctgctgcccacagaaacctgctgtccagctctgcagagacta
aacccagccccagctctgcaccagcctccgtgtgctcagcccatgatgccccaacaggat
cgaccagagcagacctccccaactagagaagcttcatctctaacagtgatgagtggaagc
tgcctcatctcagggctccagcctggtaaatcctacaagctccagctgcgcagccaacct
gatggggtctccctccatggctcctggggatcctggtccctccccgcaactgtggacctg
cctggagatgcagtggagattggactgcagtgctttaccttgaacctgaagactgttacc
tgtcagtggcagcaacagaaccacactagctcccaaggcttcttctaccacagcagggcg
cggtgctgtcccggaaacagggaccccatctgggagaagtgtgaagaggagaaaaatcca
ggattacagccctcccagttctctcgctgccacttcaagtcacgaaatgacagtgttatt
cacatccttgtggaggtgaccacagcccagggtgctgttcacagctacttgggctcccct
ttctggatccgccaggctgtgctcatccccactccaaacttgcactggagggaggtctcc
agcgggcagctggaattggaatggcaacacccatcatcgtggggagcccgagagacctgc
tatcagctccgatacacaggagaaggccatcaagactggaaggtgctggagccgcctctc
ggcgcccggggagagaccctggagctgcgcccgcgctcccgctaccgcttacagctccgc
gccaggctccacggccccacctaccaaggcccctggagcgcctggtcagatccagtgagc
gtagacactgcctccgagactgcctggatctccttggtgaccgctctgctcgtggtgctg
ggcctcagcaccctcctgggcctgctgctgctgaggtggcagtttcctgcgcactacagg
agtctgaagcatgccctgtggccctcacttccagacctgcaccgggtcctagcccagtac
cttagggatactgcagcactgagtccacccaagactgcagtctcagatgcctgtgaggaa
gtggaacccagcccccttgaaattctacccaagtcctcagagaagactcccgtggccctg
tgttcctcccaggcccagatggactaccgaagactgcctccttcttgcctggggaccatg
cctctgtctgtgtgcccaccaatggctgagatggggtcttattgtaccactcacattgcc
aaccattcctacttacctctaagctgctggcaggcccctctctcccagtaccctggacag
atccaaacccaccagacctcttttcccaacctccctacccactccaaccccacaacacaa
acttctcagacctcacgtccatccccctctgtctgtcctcatagttgggctccacgacac
tga

KEGG   Felis catus (domestic cat): 101097206
Entry
101097206         CDS       T02385                                 
Symbol
LIFR
Name
(RefSeq) leukemia inhibitory factor receptor
  KO
K05058  leukemia inhibitory factor receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101097206 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101097206 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101097206 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101097206 (LIFR)
   04090 CD molecules [BR:fca04090]
    101097206 (LIFR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL6/12 receptor family
   101097206 (LIFR)
CD molecules [BR:fca04090]
 Proteins
  101097206 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind TMEM154 DUF3827
Other DBs
NCBI-GeneID: 101097206
NCBI-ProteinID: XP_023094747
Ensembl: ENSFCAG00000018250
LinkDB
Position
A1:210821143..210899483
AA seq 1097 aa
MMNISLRLRRPSRMVDGKRMRMTSSFQRLLLTFILLYLMNQVNSQKRGAPRDLKCITNNL
QVWDCSWKAPSGAGHGTIYEVCIESRSRSCYQSEKANAKIPALLPGDHEITINRLYDFGN
PISKFTLNEKNVSLIPDTPEILNLSADFSTSTLHLKWNDRGSIFPRHLNVIWEVKILRKE
NTEIIKLVTHNTTVNGKDTVHHWSWASDMPLECTTHSVAIRCYVDDPHFSGRKEWSDWSP
LKNISWSPDSQTKVFPQDKVILVGSDITFCCVTQEKVLSAQIGQTNCPLIHLDGENVAIK
IHNISVSANSGTNVVFTTEDNIFGTVIFAGYPPDIPQKLNCETYDLKEIICTWNPGRPTA
LVGPRNTSYTLFESFSGKYVKFKRVEAPTNESYQLFFQMRPNQEIYNFTLNARNPLGRSE
STILVNITEKVYPRIPTSIRVKDINSTAVILSWHLPGNFAKIKLLCQIEINKTNSVQELR
NVTIRGVENSSYLVAVDQLNPYTVYTFRIRCSAETFWKWSKWSNEKKYLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSLDEETQSLSEIPDPQHKAELQLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKVEQAVGMGNGILLTWNYDPSMTCDYVIK
WCNTSRAEPCLMDWKKVPSNSTEAVIESDQFRPGVRYNFFLYGCRNQGYQLLRSIIGYIE
ELAPIVAPNFTVEDTSADSILVRWEDIPVEELRGFLRGYLFYFEKGERDTSKIRGLESGR
SDIKVKNITDLSQKTLRIADLQGKTSYHLVLRAYTDGGMGPEKSMFVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGNSALKTLEM
NPCTPNNVEVLETRSAVPKIEDTEIISPVAERPEESSDAEPENHVVVSYCPPVIEEEIPN
PGVDEAGGTSQVIYIDVQSMYQPQAKPEEEQESDPVGGAGYKPQMHLPITSTVEDLAADA
DLDKTAGYRPQANVNTWNLVSPDSPRSTDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatgaacatttccttacgtttgagaagaccatcccggatggtggatggtaaaaggatg
aggatgacttcaagtttccagcggctcttactaacatttattcttctgtatttaatgaat
caagtaaatagccagaaaaggggggctcctcgtgatttgaagtgtataactaacaatttg
caagtgtgggactgttcttggaaagcaccctctggagcaggccatggtactatttatgaa
gtttgcattgaaagcaggtcccgttcttgttatcagtcagagaaagcaaatgctaaaatc
ccagctcttttacctggcgatcatgaaataaccataaatcgtctatatgattttggaaat
cctataagtaaattcacactaaatgaaaaaaatgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacttctacattacacctgaagtggaatgacagg
ggttctatttttccccgtcacttaaatgtcatctgggaagttaaaattctgcgtaaagaa
aatacggaaatcataaaattagtgacccacaacacaactgtgaatggcaaagatacagtt
catcactggagttgggcctcagacatgcccctagagtgcaccacccattctgtggcaatt
agatgctatgttgacgatcctcatttctctggtcgcaaagagtggagtgactggagccca
ctgaagaacatttcttggtctcctgattcccagacgaaggtttttcctcaagacaaagtg
atacttgtaggctcagatataacattttgttgtgtgactcaagaaaaagtgttatcagca
cagattggccaaacaaattgtccccttattcatctcgatggggaaaatgttgcaatcaag
atccataatatttcagtttctgcaaacagtgggacaaatgtggttttcacaacagaagat
aacatatttgggacagttattttcgcaggatatccacctgatattcctcaaaaactgaat
tgtgagacatacgatttaaaagagattatatgtacttggaatcccggaagaccgacagca
ctggtgggcccacgcaatacaagttacactttatttgaaagtttctcaggaaaatatgtt
aaatttaaaagagttgaagcaccaacaaatgaaagctaccagttattctttcaaatgcgt
ccaaatcaagaaatatataattttactttgaatgctcgcaatcctctgggtcgctcagaa
tcaactattttagttaacataactgagaaagtttatcctcgtattcctacttcaatcaga
gtgaaggatattaattcaacagctgttatactttcctggcatttaccgggcaactttgca
aagattaaacttttatgtcaaattgaaattaataaaactaactcagtacaagaattgcgg
aatgtcacgatcagaggagtagaaaattcaagttatcttgtagctgtggaccagttaaac
ccatatactgtatatactttccggattcgctgttctgctgaaactttctggaaatggagc
aaatggagcaatgaaaaaaaatatttaaccacagaagccattccttcaaagggaccagat
acttggagagagtggagttctgatggaaaaaacttaataatctattggaagcctttgccc
attaacgaagctaatgggaaaatcctttcctataatgtgtcatgttcactagatgaggag
acacagtccctttctgagatccctgatcctcaacataaggcagaactacaacttgataaa
aatgactacatcatcagcgtggtggcaaaaaattctgttggttcatcgccaccttctaaa
atagctagtatggaaattccaaacgatgatctcaaagtagagcaggctgtcgggatggga
aatggaattctcctcacgtggaattacgatcccagcatgacttgtgactatgttattaag
tggtgtaacacctctcgggccgagccctgcctcatggactggaaaaaagtcccttccaac
agcactgaagctgtaatagaatctgatcagtttcgaccgggcgtaagatacaattttttt
ctgtatgggtgcagaaatcaaggatatcagttactgcgttctataattggatatatagaa
gaattggctccaattgttgccccaaattttactgtcgaggacacatctgcagattcaata
ttagtaagatgggaagatattcctgtggaagagcttagaggctttttaagaggatattta
ttttactttgaaaaaggagagagagacacatctaagatcaggggtttggaatccggtcgt
tctgacataaaggttaagaatattaccgacctctcccagaagacactgagaattgccgat
cttcagggtaaaacgagttaccatctggtcctgcgagcctatacagatggtggaatgggc
ccagagaagagcatgtttgtggtgacaaaggaaaattctgtgggattaattattgccatc
ctcatcccagtggcggtggcggtcattgtgggagtggtaacgagcattctttgctatcgg
aaacgagaatggattaaagaaaccttctaccctgacattccaaatccagagaattgtaaa
gctttacagtttcagaagagtgtctgtgagggaaacagcgctctcaaaacattagaaatg
aatccttgtaccccaaataatgttgaagttctggaaactcgatcagcagttcctaaaata
gaagatacagaaataatttctcccgtagccgagcgcccagaagagagctctgatgcggaa
cccgagaaccacgtggttgtgtcctattgtccgccagtcatcgaggaagaaataccgaac
ccgggagtggatgaagccggagggacctcacaagtcatttacatcgatgtccagtccatg
taccagcctcaggcaaaaccagaagaggaacaagagagcgaccccgtcgggggggcaggc
tataagccacaaatgcacctccccatcacttctactgtagaagacctggctgcagacgct
gacttagataaaactgcaggttacagacctcaggccaatgtaaatacttggaacttagta
tctccagactctcccagatccacagacagcaacagtgaaattgtctcttttggaagtccc
tgctccattaactcccgacaatttttgattcctcctaaagatgaagactctcctaaatcg
aatggaggagggtggtcctttacaaacttcttccagaacaaaccgaatgactaa

KEGG   Felis catus (domestic cat): 101097499
Entry
101097499         CDS       T02385                                 
Symbol
IFNLR1
Name
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101097499 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101097499 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101097499 (IFNLR1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101097499 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 Chromate_transp
Other DBs
NCBI-GeneID: 101097499
NCBI-ProteinID: XP_023115826
LinkDB
Position
C1:complement(18028655..18050357)
AA seq 611 aa
MRRSKPPRTPGGVSSRLGAAVARGAGGPPSSPRRGCPRGSPRRVPARGGGARGSASHWLP
SATTCRPAGGGAGAGTWRRPAGSAGAGLAGLGRWVPLLLCLLQSTQGRPHLAPPQNVTLL
SRNFSVYLTWLPGPGYSQNVTYFVAYQSAPTPRRWRKVNQCAGTKELACSLMCLEKQDLY
NKFKGRVWAVSTGSRSPPVESKYLDYLFDVEPAPPVLVVTRKEEILSINATYQLPHCMPP
PDLKYEVDFWKEGTKNKTRFPATPRGQPVQIPLQPATSGPYCLSARTIYTFGDPKYSGFS
KPTCFFLGAPGANWVFLGLLLLLLPLLLVIAIGHVIWRRFTDNPWFQQAKMPWALDFTGH
RRPVATFQPCGPESPDALILRPQKELARRVRPSPSVRTPATVQAGSEEDSAEEEKDDEED
TDDGVSFQPYIEPPPFLGQDHRTPGHSEVGGTWTPPSQAEGSSAADASDRSGASTGGSSP
RDEPESCCLTKKGPGQGPGGDGCQEPLLLHEFSQDLSFLEDPLKDNLSSWTTCFSSPGLN
LVPGEPPVSLHTLTFCWDSSPEEEEEEEGEEEGGGGERESEIEGDVTGNWRAESLQKAEV
RGGTLGHYMAR
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcggcggagcaaaccgccacgcacacccggaggagtttccagccgtcttggagccgcg
gtggcgcggggagccggcgggccgcccagctcgccgcgccggggctgcccccggggaagc
ccccgccgagtcccggcccgcgggggcggggcccgcggctcggcctcccattggctgccg
tccgcaaccacctgccggccggcgggcggcggggccggagcggggacctggcggcgcccg
gcgggcagcgcaggagccggcctggcggggctcggccggtgggtccccctgctcctgtgc
ctgctgcagtccactcaagggaggccccatctggctcctcctcagaacgtgacgctgctc
tcccggaacttcagtgtgtacctgacatggctcccagggcctggctactcccagaatgtg
acctattttgtggcctaccaaagcgctccgacccccagacggtggcgaaaagtgaaccag
tgtgcgggaaccaaagagctggcctgttctctgatgtgcctggagaaacaagacctgtac
aacaagttcaaggggcgtgtgtgggcagtttctaccggctccaggtcccccccggtggag
tccaagtacctggattacctttttgacgtggagccagccccacccgtcctggtagtcacc
cggaaggaggagattctgagcatcaatgccacatatcagctgccacactgcatgccccca
ccggatctgaagtacgaggtggatttctggaaggagggaacaaagaataagacacgattt
ccagccactccccgtggccagccagtccagatccccctgcagccagccaccagcggaccc
tactgcctcagtgccagaaccatctacacctttggtgatcctaagtacagtgggttctct
aagcctacctgcttcttcctgggggccccaggagccaactgggtattcctggggttgcta
ctgcttctgcttccactgctgttggtcattgccataggccatgtgatctggaggaggttc
acggacaacccctggtttcagcaggcaaagatgccctgggccctggactttactggacac
agacgccccgtggcaacctttcagccctgtggccctgagtccccagatgccttgatcctc
cgtccccaaaaggaactggccagaagggtcaggccgagccctagtgtcaggaccccagcc
accgtccaggcaggatcagaggaggacagtgctgaggaggagaaggacgatgaggaggac
acagatgatggtgtcagcttccagccctacattgaaccaccgcccttcctggggcaggac
caccggaccccggggcactcggaggtggggggcacctggactcctcccagccaggccgaa
ggctcctcggctgcggatgcttcagacagaagcggggccagcactgggggctcctctccc
cgggatgagcccgagtcttgttgtttaaccaagaagggaccgggccaagggccaggtggg
gatgggtgtcaggagcctctcctcctccacgaattctcccaggacctgagtttcctggaa
gatcccctgaaagacaacctttcctcctggaccacctgcttttcatcaccagggctcaat
ctggtccctggggagcccccagtttctcttcacacactgaccttttgctgggacagcagc
cctgaggaggaagaggaggaggagggggaagaagaaggaggaggaggggagagggaatca
gaaatcgagggtgacgttactggcaactggagggctgagagcctccagaaggctgaagtc
agaggcgggacactagggcattacatggccaggtaa

KEGG   Felis catus (domestic cat): 101098275
Entry
101098275         CDS       T02385                                 
Symbol
IL9R
Name
(RefSeq) interleukin-9 receptor isoform X1
  KO
K05073  interleukin 9 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101098275 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101098275 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101098275 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101098275 (IL9R)
   04090 CD molecules [BR:fca04090]
    101098275 (IL9R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101098275 (IL9R)
CD molecules [BR:fca04090]
 Proteins
  101098275 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 101098275
NCBI-ProteinID: XP_023102227
Ensembl: ENSFCAG00000003079
LinkDB
Position
E3:44576306..44588057
AA seq 599 aa
MQQALHQSKVESPKPTFGVMGKEGSSHLLVPGFMISGSSCVSTPLGTAALICIVVSDVGG
LCQPAVGGSRHCSLQLYPESGRETSLQTQERSPPGLEVGGGGALRLAMGPSRCIWEGWTL
ETEALMRELSTWLLICTCISPWVGLGVSIHGEGGGLGAGSFICLNNNILRIDCHWSAVEL
GQGPSPWLLFTSNHAVGSNHRCVFRASECTLVLPPEEVLVPSDNFTITFHRYVSGKEQVS
LVDPQYLPRRHVKLDPPSDLQSNVSSDYCVLTWSVSPALEPLISMLSYELAFKRQGETWE
QAQHRDHIFGVTWLRLEAIELDPGSSYEARLRVQMASPEDDLAEEQHYAGQWSDWSQPVC
FPSPQTSARGPLLSPRGQPDGTLVAVPVFLLLTSLTCLLFKLSPRVKRSFYQNVPSPVAF
FQSLYSVHNGDFQTWIGAHRTGLLPSQDCVGSPRRASESSVQEAIAWLTYGPVDPWQSVV
LEEEEKGPRPGLPEAVLLAGRVAQGEQPPAYLPQEDWVPGSPTRPALPQAEGSSGDYCAL
GCPGACHPSTFPGSMQSSGPSLALACGLSCDQQSLDATQGGTCVGVGHREEQDPGECVA
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgcagcaggcactccaccaatcaaaggtcgaatcaccaaagcctacctttggtgtcatg
gggaaagaaggatcatcccaccttctagttcccgggtttatgattagtggtagcagttgt
gtctcaaccccactggggacagctgctctgatctgcatcgtggtttcagatgtgggcggc
ctgtgtcagcctgccgtgggaggctcacgtcactgctcactgcagttatatcctgaatca
ggcagagagacttcgctgcaaacgcaggagcggtcacctccaggtctggaggttggtggg
gggggggccctccgacttgccatgggacccagcagatgcatctgggaaggatggaccttg
gagactgaggccctgatgcgggagttgagtacctggctcctgatctgcacgtgcatcagc
ccttgggttggcttgggagtctccatccacggggaaggaggagggctcggggctggatct
ttcatctgcctcaacaacaacatcctaaggatcgactgccactggtcggctgtagagctg
ggtcagggccccagtccctggctcctctttaccagcaaccacgccgtgggcagcaatcac
agatgtgtcttccgggccagcgagtgcactctggtgctgccgcctgaggaggtgcttgtg
ccttctgacaacttcaccatcactttccaccgttatgtctctgggaaggagcaggtcagc
ctggtggacccacagtacctgccccggagacatgtgaagctggaccctccctctgatttg
cagagcaatgtcagctctgactactgtgtcctgacctggagcgtcagccctgctttggag
cctctgatctccatgctcagctatgagctggccttcaagaggcagggggagacctgggag
caggcccagcacagggatcacatttttggggtgacctggctcaggcttgaagccatcgag
ttggaccctggttccagctacgaggccaggctgcgcgtccagatggcctcgccggaggat
gacctggcggaggaacagcactatgcgggccagtggagtgactggagccagcctgtgtgc
tttccctctccccagacctctgcccgaggccccctgttatcacctcgggggcagcctgac
ggcacccttgtcgctgtacctgtctttctgctactgaccagcctgacctgcctcctgttc
aagctttcacccagggtgaagagaagcttctaccagaacgtgccgtctcccgtggccttc
ttccagtccctgtacagtgtgcacaatggggacttccagacctggataggggcccacaga
accggtctgctgccgagccaggactgtgtcggttccccgagaagagcctcggagtctagt
gtccaggaggccattgcgtggctgacctatggcccagtggatccctggcagtcagtggtc
ctggaggaagaggagaaaggcccacgtcctggcctcccagaggctgtgttgttagcaggt
cgtgtggcacagggagagcagccacctgcctacctgccacaggaggactgggtccctggg
agccccaccaggccagctctcccacaggcagagggcagcagtggtgactactgtgccttg
ggctgtcctggggcgtgccacccctcgaccttcccaggaagcatgcagagctctgggccc
agcctggctttggcctgtggcctttcctgtgaccagcagagcctggatgccacgcaagga
gggacctgtgtgggagttggtcacagagaggagcaagaccctggtgaatgtgtcgcatga

KEGG   Felis catus (domestic cat): 101099031
Entry
101099031         CDS       T02385                                 
Symbol
IL5RA
Name
(RefSeq) interleukin-5 receptor subunit alpha isoform X1
  KO
K05067  interleukin 5 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101099031 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099031 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101099031 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099031 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101099031 (IL5RA)
   04090 CD molecules [BR:fca04090]
    101099031 (IL5RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101099031 (IL5RA)
CD molecules [BR:fca04090]
 Proteins
  101099031 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101099031
NCBI-ProteinID: XP_011278466
Ensembl: ENSFCAG00000000652
LinkDB
Position
A2:complement(44889535..44924754)
AA seq 417 aa
MAPALLILLGATVILSADSLSDKKSLLLPPTNFTIKVTGLSQVLLRWESNPDQEPVNIEL
GYHVRINAPQEEDYETRNTESKRVTVLHKGFSASVQTVPWNGQPLPPSRWVSAELKAPPG
SPGTSIVNLTCTTNTTVNNHTPLRPYQVSLHCSWLAGKDAPEDTQYFLYYRYGSWTEECQ
EYRRDTLNRNTACWFPKTFISSRGSEALAVHANGSSKHAPIKPFDQLFALHAIDRINPPV
NVTAEIEGTCLSIQWEKPVSAFPIHCFEYEVKIYNTRKKYFQTEKLMTNAFISIIDDISK
YSVQVRATVSSMCRQMGFWSEWSQPIYVGSDDQKPSTEWFLIVLMAAICFILLIFSFICK
TGHLWTRLFPPVPAPKSSIQDFFVIVSSEKTVSTETEIEVISYVEDPGFETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcacctgcattactgattctcttgggggctacagtgatactgagcgcagactcactt
tctgataaaaaatctttacttctcccacctaccaacttcactatcaaagttactggcctt
tcccaagttcttttgcgttgggaatcaaatcctgatcaagagccagtgaatatagagcta
ggctatcatgtgagaataaatgctccacaagaagaagactacgaaaccaggaacactgaa
agcaaacgtgtaaccgttcttcataaaggcttttcagcaagtgtgcagacggtcccttgg
aacggccagcccctcccaccaagccgctgggtttctgctgaacttaaagccccacctggg
tctcctggaacctcgattgtgaatttaacatgtaccacaaacaccacagtgaataatcat
actcccttaaggccataccaagtttctcttcactgctcctggctagctggcaaggatgcc
cctgaggatacacagtattttctctactataggtatgggtcctggaccgaagaatgccag
gagtacaggagagacaccctgaacagaaatactgcatgctggtttccaaagacttttatc
agcagcagaggaagtgaggcactcgcagtgcatgctaatggctcaagcaagcatgcacca
atcaagccttttgatcagctgtttgctcttcatgcaatcgatcgcattaatcctccagtg
aatgtcacagcagagattgaaggaacctgtctttcaattcagtgggaaaaaccagtttct
gcctttccaattcactgctttgaatatgaagtgaaaatttacaacacaaggaaaaaatat
ttccagacagaaaaactgatgacgaatgcattcatctcaataattgatgatatttctaag
tattccgttcaagtgagagccaccgtgagttctatgtgcagacagatggggttttggagc
gagtggagtcaacctatatacgtgggaagtgatgaccagaagccctccacagaatggttt
cttatcgtgcttatggcggccatctgcttcatcttgctaattttctccttcatctgtaaa
acaggtcacttatggaccaggttgtttccaccagttccggcaccaaaaagtagtattcaa
gatttctttgtcatcgtcagctctgagaaaactgtttccactgaaacagaaattgaagtc
ataagttatgtggaagaccctggatttgagaccctggaagattctgtgttttga

KEGG   Felis catus (domestic cat): 101100114
Entry
101100114         CDS       T02385                                 
Symbol
IL13RA2
Name
(RefSeq) interleukin-13 receptor subunit alpha-2 isoform X1
  KO
K05077  interleukin 13 receptor alpha-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100114 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100114 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100114 (IL13RA2)
   04090 CD molecules [BR:fca04090]
    101100114 (IL13RA2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101100114 (IL13RA2)
CD molecules [BR:fca04090]
 Proteins
  101100114 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101100114
NCBI-ProteinID: XP_006944003
Ensembl: ENSFCAG00000003202
UniProt: A0A2I2ULM4
LinkDB
Position
X:complement(96523327..96570455)
AA seq 386 aa
MAFVHLDVLCFYSLLICTAFSSVSSNAEIKVNPPQDFEIVDPGYLGYLCLQWQPPLFLDK
FEECTVEYELKYRNIDSEDWKTIITKNLHYNDGFDLNKGVEAKIHTLLPPHCTNGSEVQS
LWSEATYWKSPQGSQETKIQEMDCVYYNWEYLLCSWKPGLGVHFHTSYQLFYWYDGLDHA
TQCPDYIKVDGQNIGCRFPHLEASDYKDFYICVNGSSDSYPIRPSYFIFQLQNIVKPLPP
DYLSLTVKNSEEVNLKWSMPQGPIPAKCFIYEIEFTEDDTTWVTTTVENEIRVARISNES
QQLCFLVRSKVNIYCSDDGIWSEWSDEQCWKDDIWKETLVFFLTPFAFVSLFVLLVTCLL
LYKQKAVLKTIFQRKQEVFSHQDTFC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctttcgttcatttggacgtcctatgcttctatagcctactcatttgcacagcattt
agttctgtgtcttcaaatgctgagataaaagttaatcctcctcaggattttgagatagta
gacccaggatacttaggttatctctgtttgcaatggcaacctccactgtttctggataag
tttgaggaatgcacagtagaatatgaattaaaataccgaaacattgatagtgaagactgg
aagaccatcattaccaagaatctacattacaacgacgggtttgatcttaacaaaggcgtt
gaagcaaagatacacacgcttctgcccccgcactgcacaaatggatcagaagttcaaagt
ttatggtcagaagctacttactggaaatcaccccaaggaagtcaggaaaccaagattcag
gaaatggattgtgtgtattacaactgggagtatttactctgctcctggaaacctggtctg
ggtgtccattttcataccagttatcaattgttttactggtatgacggcttggaccatgcc
acacagtgtcctgattacatcaaggttgatggacaaaatattggatgcaggtttccccat
ttggaggcatcagactataaagatttctacatctgtgttaatggatcatcagactcttat
cccatcagacccagctattttatttttcagcttcaaaatatagttaaacctttgccgcca
gactaccttagtcttactgtgaagaactcagaggaagttaacctgaaatggagcatgcct
caagggcccattccggcgaaatgctttatttatgaaattgaattcaccgaagatgataca
acttgggtgactaccaccgtcgaaaatgagatacgcgtcgcaagaatatcaaatgaaagc
caacaattatgctttttggtaagaagcaaagtcaacatctattgttcggatgacggaatc
tggagtgagtggagtgacgaacagtgctggaaagatgacatatggaaggaaaccttggta
tttttcttgacaccatttgcttttgtctcattgtttgttttgttagtaacttgtctgctt
ttgtacaagcaaaaagctgtactgaaaacgatctttcagaggaaacaagaagtcttttct
catcaagacacattctgttga

KEGG   Felis catus (domestic cat): 101100367
Entry
101100367         CDS       T02385                                 
Symbol
CRLF2
Name
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100367 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100367 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100367 (CRLF2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101100367 (CRLF2)
SSDB
Other DBs
NCBI-GeneID: 101100367
NCBI-ProteinID: XP_023105062
LinkDB
Position
X:complement(912887..936497)
AA seq 370 aa
MRTVFLPCAAAALFLLGRATASGDAGQEPVLQVWIINFNFETVRVTWSPSRYSGTNLTFV
YKLSSDEASRPCCNYIVHEGHTAGCLLEARKDEILCFSLGNGTDILFRKCEWISAYLKPS
SPEDLNFRWHEDAVTVTCSDLPYKRLLYEIQYKSVFDTEWQSKEGETCNVTIQALDSEKC
YFFRARVKTLESSYGSDTYPSDWSKVTHQQRGELRDSCQEKRLFPKFILICGMIALLTVS
LLLLSLWKVRRLHKCLMPSVPDPKLTFPGLFELHRGNFQEWIKDTQNVSHVAKTEATEQE
CVPEETLVVQLQKAEAEMPIVTTGPLCPPTEGEEASGDASPVACQPPQGGEVVSLGGFTF
VMTDNSYMLL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaggacagtcttcctgccctgtgcagcggctgccctgtttctgctgggacgtgcgacg
gcttcgggggacgcgggacaggaaccagtcctgcaggtttggattatcaactttaacttt
gagactgtgcgggtcacatggagcccgagccgatactcggggacaaatctgactttcgtc
tacaagttgagtagcgatgaggccagtcgcccatgctgcaactacatcgttcacgaaggc
cacactgccggctgcctcctggaggcaagaaaggacgaaattctgtgcttttcccttggg
aacggaacggatatccttttccgaaagtgcgagtggataagcgcgtacctgaaacccagc
tccccagaagatttgaatttccgctggcatgaagacgctgtgacggtcacctgttctgac
ctgccctacaaacgtcttctctacgaaatccaatacaagagcgtattcgacacggagtgg
cagtcgaaggagggtgaaacctgcaatgttacgatacaagccttggattctgagaaatgt
tatttcttccgggccagagtcaaaacactggagtccagctacggctctgacacttaccca
agtgactggtccaaggtgacacaccagcagaggggcgagctgagagattcatgccaggag
aaaaggcttttccccaaatttattttaatttgtggtatgattgccttgctgaccgtgtcc
cttctccttctgtctttatggaaagtacggagacttcacaagtgcctcatgcccagcgtg
cccgatcccaagctcaccttccctgggctctttgaactgcaccggggtaacttccaggag
tggatcaaggatacacagaacgtgtcccacgtggccaagacggaggccacggagcaggag
tgtgtccccgaagagacccttgttgtccagctccagaaggccgaggccgagatgcccatc
gtgacgactggcccgttgtgccctccaacggagggggaagaggcctccggggacgccagc
ccggtcgcgtgccagcccccacaagggggcgaggtggtctctctggggggcttcacgttt
gtgatgactgacaactcatacatgctgttatga

KEGG   Felis catus (domestic cat): 101100621
Entry
101100621         CDS       T02385                                 
Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100621
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100621
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101100621
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100621
   04090 CD molecules [BR:fca04090]
    101100621
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101100621
CD molecules [BR:fca04090]
 Proteins
  101100621
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101100621
NCBI-ProteinID: XP_019679058
LinkDB
Position
X:975880..994473
AA seq 451 aa
MSSLGTVGILGQEPHNVTNHPVKRATLPWVPCPPPLGLPRPPSRPLGPLATTILFCMLLD
PALPLTQEHQDVPTTEWVPSLNMKFDRRTMELSWDCKENTTYLECVMIHKEKGEIRKKPK
NKDCHCNFSHDSLHGGVTFVVKVNSTQGPIPEKLVYANPGGEGTAAQNFSCFIYNVNFMN
CTWAKGRAAPDDVQYFLYIQDFKEKRERECPHYVTDSGTHVGCHLHDLSGLTFRNYFLVN
GTSRETAVQFFDTILSLKKIEIYSPPNNVSVDCNPSHCQILWDPPRTRHPSSAWDFNYQL
RIQKQNNKEHAGNQLIDVTGKSENKYNFPSPEPRPKHTVTIRASDARGQHWSAWSQPVEF
GSTQATASFVHIYVLVVLGTFVCALILSCLVKRLFASETLFPRIPHIKDKWSENVHTDHQ
IIWEKSTPDTGKIDHEEILTVEEVTVAPESV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtcctccttggggactgtcggcatcctcggccaagagccgcacaacgtgactaaccat
ccagtcaaaagagcaaccctcccgtgggtcccctgcccgccacccttggggcttcctcgt
cctcccagccgccccctgggacccttggccacaaccatcctgttctgtatgctgctggac
ccagcgttacccctgactcaggagcaccaggatgttccaaccacggaatgggtccccagt
ctaaatatgaagtttgaccgaaggacaatggaactgagttgggactgcaaagaaaacact
acctacctcgaatgtgtgatgatccacaaggagaaaggagagatcagaaaaaagcccaag
aacaaagactgtcactgcaacttttcccatgattctctccatgggggagtcacgttcgtg
gttaaagtaaatagcacccaaggaccgattccagaaaaactggtctacgctaacccaggt
ggcgagggcaccgctgcccaaaacttctcctgttttatctacaacgtgaacttcatgaac
tgcacttgggcgaaaggtcgggctgcgcctgatgacgtccaatatttcttgtacatacaa
gactttaaggaaaaaagggaaagagagtgtcctcattacgtgacggactcaggaacccac
gtcggatgtcacctgcacgatctgtcgggactaacgttccgcaattacttcctggtgaac
ggtaccagccgagagacagcggtccagttttttgatacgattttgtccttgaaaaaaata
gaaatatacagcccgcccaacaacgtcagcgtcgactgcaacccgtcccactgccagatc
ctctgggacccgcccaggacgcgacacccctcgtccgcctgggacttcaactaccagctg
cgcatccagaaacagaacaacaaggaacacgccggaaatcaactgatcgatgtgaccggc
aaatcggaaaataaatacaacttcccgagtccagagcccagacccaagcacactgtgaca
atacgggcctcggacgcacggggacagcattggagcgcctggagccagcccgtggagttt
ggctccacacaagccacagccagctttgtgcacatctatgtgctcgtggtcctggggacc
ttcgtctgtgccctgattctcagctgccttgtgaaaaggttgtttgcatcagagacctta
ttcccgcggattccgcacatcaaggataaatggagtgagaacgttcacactgaccaccag
atcatctgggagaaatccaccccggatacaggaaagatcgaccatgaagaaatcctaacc
gtggaggaagtcaccgtcgccccggagagcgtgtga

KEGG   Felis catus (domestic cat): 101100697
Entry
101100697         CDS       T02385                                 
Symbol
IL7R
Name
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100697 (IL7R)
   04068 FoxO signaling pathway
    101100697 (IL7R)
   04151 PI3K-Akt signaling pathway
    101100697 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100697 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101100697 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100697 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    101100697 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100697 (IL7R)
   04090 CD molecules [BR:fca04090]
    101100697 (IL7R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101100697 (IL7R)
CD molecules [BR:fca04090]
 Proteins
  101100697 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 101100697
NCBI-ProteinID: XP_006928117
Ensembl: ENSFCAG00000009200
UniProt: M3WAZ4
LinkDB
Position
A1:complement(213267824..213296226)
AA seq 457 aa
MMILGTAFGMVFYLLQVVSGESGYAQNGDFDDAELDDYPFSCYSQLEVDGSQHLLTCTFD
DPDVNSTNLEFEICGALLDVKCLTFNKMQEMYFIRTKKFLLIGDSEICVKLKGKKITCRK
MNVVKIVKPEAPFDVRVIYREGANDFLVTFNTSHLQKKYVKELLHEVAYRQEKHENDWMH
VNLSSTKLALLQRKLQPDAMYEIKVRSIPNHDYFEGFWSEWSPSFHFRTPEITGRMDPIL
LTISILSFFSVSLMVILACALWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPES
FLDCQIHKVDGIQARDEAEGFLQDTSLPQPEESEKQRLVGGVQSPTWPSEHAVITPKTFR
GDSPLGCLAGNVSMCEALVLPSSRPPDFRDGGKNGPHVYQGLLLVPGTTNGPGPTPFPFQ
SGILTLNPAAQGQPILTSLGSSQEEAYVTMSSFYQNQ
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatgattctaggtacagcttttggtatggttttctatttacttcaagtcgtttctgga
gaaagtggctatgcacagaatggggactttgatgatgccgaactggatgactatccattc
tcgtgttacagtcagttggaagtggatggatcccagcacttgctgacctgtacttttgac
gacccagatgtcaatagcaccaatctggaatttgaaatatgtggggctcttttggatgtg
aaatgcctgacttttaataaaatgcaagagatgtatttcatcaggacaaagaaattctta
ctgattggagacagcgaaatatgtgtgaagcttaaaggaaaaaagataacttgcaggaaa
atgaacgtagtcaagatagttaaacctgaggctccttttgacgtaagagtcatctatcgt
gagggagcaaatgactttctggtgacatttaacacatctcacttacaaaagaagtatgtg
aaagaattattgcatgaggtagcctatcgccaggaaaaacatgaaaatgactggatgcat
gtgaacttatccagtacaaagctggcactcctacagagaaagctacaacctgatgcaatg
tatgagattaaagtccggtccattcctaatcatgactattttgaaggcttctggagtgaa
tggagtccaagcttccacttcagaactccagagatcacagggaggatggatcctatttta
ctaactattagcattctgagtttcttctctgtgtctctgatggtcatcttggcctgtgca
ttatggaaaaaaagaattaaacctattgtgtggcccagtctcccggatcataagaagact
ctggaacaactttgcaagaaaccaaaaaagaatttgaatgtgagtttcaatcctgaaagt
ttcctggactgccagattcataaggtggatggcattcaagctagagatgaagccgaaggc
tttctgcaagacacttctctgccacaaccagaggagtctgaaaagcagaggcttgtaggg
ggtgtgcagagccccacctggccatctgagcatgcagtcatcaccccaaaaacgttcaga
ggagattcacccctcggatgcctggctgggaatgtcagtatgtgtgaggcccttgtgctc
ccatcttccagacccccagacttcagggatggtggcaagaatgggcctcatgtgtaccag
ggcctgctgcttgtccctggaactacaaatggccctgggcccactccatttcctttccaa
tcaggaatcctgacattgaacccagctgcccagggacaacccattctcacttccttggga
tcgagccaggaagaagcctatgtcaccatgtccagtttctaccaaaaccagtga

KEGG   Felis catus (domestic cat): 101100741
Entry
101100741         CDS       T02385                                 
Symbol
IL22RA1
Name
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100741 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100741 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100741 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100741 (IL22RA1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101100741 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101100741
NCBI-ProteinID: XP_019691954
Ensembl: ENSFCAG00000006118
LinkDB
Position
C1:complement(18001484..18020670)
AA seq 581 aa
MRTLLTILAVGSLAAHVAEGTSDLLQHVKFQSSNFENILTWDSRPESAPDTVYSVEYKKY
GEREWLAKEGCQRITRKSCNLTLETGNPMEHYYARVTAISAGGPSATKMTDRFSSLYHTT
IKPPNVTCIPKVRSIQMIVHPTTTPIHTGDGHRLTLEDIFPDLSYHLELQVNHTYQMHLG
GKQREYEFIGLTPDTEFLGAIRIFVPALVRESDPYTCRVKTLPDRTWTYSFSGAFLFSMG
FLVAGLCYLSYRYVTKPPPPPNSLDVQRVLTFQPLRFIQEHVLIPVFDLSSPSGLAQPVQ
YSQVKVSGPGEPPGAPPLHSLSEITYLGQPDISVLRPSGVPPHQALSPLSCAPQASPEVR
PPPYAPQVTPEAKPPSYMAQAISEVPPPSYTPQTTPDSWPSSYGMCVEGSGKDSPPVTLS
SPKHLRPKGQLQKEAPAGRYIPDGLSLQGVTSLDMGDPQEANSFHQHLGVHTDRVPDPSV
LHRGELGTPSYLKGQLPLLSSVQIEGHPVSLPLNTPSLPCSPTDQEPSPWGLLESLVCPK
DEEPVSETEAQSPAPQASDLKQPTELDSLFRDLALTVQWEA
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggacgctactgaccatcctggccgtgggatccctggccgctcacgtggctgagggc
acctcggatcttcttcaacacgtgaaattccagtccagcaacttcgaaaacatcctgacg
tgggacagcaggccggagagcgccccagacacggtctacagtgttgagtataaaaagtat
ggagagagagagtggctggcaaaggagggctgccaacggatcacccggaaatcctgcaac
ctgaccttggagacgggcaaccccatggagcactactatgcccgcgtaactgctatcagc
gctggaggcccgtcggccaccaagatgaccgaccggttcagctccctgtatcacactacc
atcaaaccacccaatgtgacctgtatccccaaggtgagatccatccagatgattgtccat
cccaccaccacgcctatccacacaggggatggccaccggctaaccctggaggacatcttc
cctgacctgtcctaccacttagagctccaggtcaaccacacctaccagatgcaccttgga
ggcaagcagagggaatacgagttcattggcctgacccccgacacagagttccttggagcc
atcaggatttttgttccagccttggtcagagagagcgacccctacacgtgccgagtgaag
accttgccagatcggacgtggacatactccttctcgggcgccttcctgttctccatgggc
ttcctcgtcgcagggctctgctacctgagctacagatatgtcaccaagccacctccgcct
cccaactccctggacgtccagcgagtcctgaccttccagcctctgcggttcatccaggag
cacgtgctgatccctgtcttcgacctgagcagccccagcggtctggcccagcccgtccag
tactctcaagtcaaggtctccgggcccggggagcccccgggagccccaccgctgcacagc
ctgtctgagatcacctacctcgggcagccagacatttccgtcctccggccctctggagtg
ccgcctcaccaggcactctccccactgtcctgtgcgccccaggcttccccggaagttagg
cccccaccctatgcacctcaagtaacccccgaagctaaacctccatcatacatggcacag
gccatctctgaggtcccgcctccctcctacactcctcagaccactccagacagctggcct
tcttcctatgggatgtgtgtagaaggttctggcaaagactccccacctgtgacactctct
agtcccaaacacctcaggcctaaaggtcagctccagaaagaggcaccagctggaaggtat
atccccgatggcctttctctgcaaggggtgacctccttggatatgggggacccccaggaa
gcaaattccttccaccagcatctgggagttcacacggacagagtacctgaccccagtgtg
ctacacagaggggaactagggacaccgtcgtacctgaagggccagctccccctcctctcc
tctgtccagatcgagggccaccctgtatccctccctttgaacactccttccctcccctgt
tcccccacagaccaggaaccaagtccctggggcttgctggagtccctcgtgtgtcccaag
gacgaggagcctgtatctgagactgaggcccagagcccggcccctcaggcatcagacctg
aagcagcccacagaactggactctctcttcagagacctggccctgaccgtgcagtgggag
gcctga

KEGG   Felis catus (domestic cat): 101101444
Entry
101101444         CDS       T02385                                 
Symbol
PRLR
Name
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04080  Neuroactive ligand-receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101101444 (PRLR)
   04151 PI3K-Akt signaling pathway
    101101444 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101101444 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    101101444 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101101444 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101101444 (PRLR)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  Prolactin receptor family
   101101444 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Interfer-bind
Other DBs
NCBI-GeneID: 101101444
NCBI-ProteinID: XP_003981512
Ensembl: ENSFCAG00000008827
UniProt: A0A2I2U3Q9
LinkDB
Position
A1:213773704..213934731
AA seq 624 aa
MKESVASTIFVLLLFLNTRLLNGQSPPGKPEILKCRSPEKETFTCWWKPGEDGGLPTNYT
LTYHKEGETLTHECPDYTTSGPNSCYFNKKHTSIWTMYIITINATNQMGSTSSDPRYVDV
TYIVEPDPPVNLTLELKQPEDKKPYLWMKWFPPTLVDVRSGWLTLQYEIRLKPEKATEWE
THFAGQQTQFKILSLYPGQKYLVQVRCKPDHGFWSEWSPESSIQIPNDVTMKDTIVWIFV
AVLSAVICLIMVVAVALKGHSMVTCILPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDF
PPTSDCEDLLVEFLEVDDSEDQQLMPALSKEHPGQDRKPTPLDPDSDSGRGSCDSPSLLS
KKCEEARANPSTFNTPEGIEKPENPQTNATRTWDPQSTRLEGKIPSFPANGSKSSTWPLP
QPPSHPSPRSSYHNIADVCKLAMGPAGASATSLDKTDTHALRSPKNVETGGEKVAVEQRA
VESFHSKTDRGTAWLLTREKTSLISVKPLDYVEIHKVNKDGALSLLPKQKENGNQTDKPS
TPETSKEYAKVSRVMDNNILVLVQDPQAQNLASFEEPAKGAPPPLQPNQAEEDLASFTSA
PSNCGLQQGGLDYLDPTCVMHSFQ
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgaaggaaagtgtggcatccacaattttcgttttgctactttttctcaacaccagactc
ctgaatggacaatcacctcctggaaaacctgagatccttaaatgtcgttctcctgaaaag
gagacattcacctgctggtggaagcctggggaagatggaggtctccctaccaattacaca
ctgacttaccacaaggaaggagagacactcacacatgaatgtccagactacacaaccagt
ggccccaattcctgttacttcaacaagaagcacacctccatctggacaatgtacatcatc
acaataaatgccacaaaccagatgggaagcacttcctcagatccacgttatgtggacgtg
acttacatagttgaaccagaccctcctgtgaacctgactttggagttaaaacagccagaa
gacaaaaaaccgtatctgtggatgaaatggttcccacccaccctggttgatgtaagatct
ggttggctcacactccagtacgaaattcgattaaaacccgagaaagccactgagtgggag
actcattttgctgggcagcagactcagtttaagattctcagcttatatccaggacagaaa
taccttgtccaggttcgctgcaagccagaccatggattttggagtgagtggagcccagag
agctccattcagatacctaatgacgtcaccatgaaagataccattgtgtggatctttgtg
gctgttctttctgctgtcatctgtctgattatggtcgtggcagtggctttgaaaggccac
agcatggtgacctgcatccttccaccagttcctgggccaaaaataaaaggatttgatact
catctgctggagaagggcaagtctgaagaactgctgagtgccctggggtgccaagacttc
cctcccacttctgactgtgaggacttactggtggagtttttagaagtggatgacagtgag
gaccagcagctgatgccagccctttcaaaagaacacccgggtcaagataggaagcccaca
cccctggacccagacagtgactctggccggggcagttgcgacagcccttcccttttgtct
aaaaagtgtgaggaagcccgggcaaatccctccacatttaacactcccgagggcattgag
aagccagagaatccccagacaaatgctacccgcacctgggacccccagagcacacgcttg
gaaggcaaaatcccctctttccctgccaatggatccaaatcttcaacatggcctttacca
cagccccccagccatcccagccccagatcttcttaccacaacattgctgatgtgtgcaag
ctggccatgggcccagcaggtgcatcggccacttcgttggacaaaacagacacacatgct
ttaagatctccaaaaaatgttgagactggaggggagaaagtggcagttgagcagagggca
gtggaaagcttccattccaagactgaccgaggcacagcatggctgttgacccgggagaaa
acctctttgatctctgtgaaacccttggactatgtggagattcacaaagttaacaaagat
ggagcactatcattgctcccaaaacagaaagagaacggcaaccagacagacaagcccagc
actcctgaaaccagtaaggagtatgccaaggtgtccagggtgatggataacaacatcctg
gtgttagtgcaggatccgcaagctcaaaacctggcttcatttgaagaaccagccaagggg
gctccaccgccccttcaaccgaatcaagctgaagaagacctggcctccttcacgtcggca
ccaagcaactgtggactccagcagggtgggttggattacctggatcccacatgtgttatg
cactcctttcagtga

KEGG   Felis catus (domestic cat): 102901718
Entry
102901718         CDS       T02385                                 
Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102901718
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102901718
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102901718
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102901718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    102901718
   04090 CD molecules [BR:fca04090]
    102901718
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   102901718
CD molecules [BR:fca04090]
 Proteins
  102901718
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 102901718
NCBI-ProteinID: XP_019679061
LinkDB
Position
X:1000391..1023639
AA seq 410 aa
MVAVLDLVTFLVVLKSACCAQPRPAQDKISPIINMQLDSRKKMLTWTYTRNVSHQECTID
TPTAYSATVNPQVTEDHTYVCTFPNSVLHRGANLTVNVTCDGDVFLQVLTFANPGREGSG
AVNFSCLIYNVRLMNCSWAPGPAAPADVKYRLFWASRHEADAECVHYILGPTGTRVGCHF
DQLGKPQRTDNYFFLVNGTSRETAIPFLDFTPFKAVQIEKYNPPRNITITYNRSHHIIRW
EHPEIRFDLSSHMLYYELHIQTPASSAETNRVFQRGQDPNVYLMPSSATRAKSAFRVRVR
YMYNRLWSEWSPTQRFGLPEQDFSGALVGPVVGTAALSALVLKFLCKRFSVRRKMFPPIP
QVKKEIAKALMPTAGVSDPSICTQEVAWDEGHPPPGPQDPEDVVTLEATC
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtggccgtgctggatcttgtgaccttcctggtcgtcctgaagtcggcatgctgtgca
caaccacggccggcgcaagacaaaatatcccctattataaacatgcagctggattcaagg
aaaaaaatgttaacctggacttacaccagaaacgtgagtcaccaggaatgcacaatagat
acgcccactgcctattccgccacggtgaacccacaggtgacggaggaccacacctacgtc
tgcaccttccccaactccgtgctgcacaggggggccaacctgaccgtgaacgtcacttgc
gacggggatgtgttcctccaagtcctgactttcgccaacccaggcagggaaggttccgga
gccgtgaacttctcctgcctcatttacaacgtgcgcttaatgaactgcagctgggcgccc
ggcccggccgccccggccgacgtcaagtatcgactgttctgggcgtccaggcatgaggcc
gacgcggaatgcgtccattacatcctcggccccacggggacccgcgtgggctgccatttc
gaccaactgggcaaaccccagaggacggataattacttcttcttggtgaacggaaccagc
agggaaacggcgatcccgtttttggatttcactccatttaaggccgttcaaatcgagaag
tacaatccaccgaggaacatcaccatcacctacaaccggtcgcaccacatcatccggtgg
gaacatcccgagatccgattcgacctttcaagtcacatgctgtattacgagctgcacatc
caaacgccggcgagctccgcagaaacaaaccgtgttttccagaggggacaggaccccaac
gtgtacctgatgcccagttccgccaccagagccaagagcgccttccgggtgagggtgcgt
tacatgtacaaccgactgtggagcgaatggagccccacgcagcggttcggcctcccggag
caggatttcagtggcgccctggtggggcccgtggtggggaccgcggctttgtccgcgctc
gtcctcaagttcctctgcaaacggttctccgtgaggcgcaagatgttccctcccatcccg
caggtgaagaaggaaatcgccaaggccctcatgcccacagcgggggtgagtgacccctcc
atctgcacccaggaggtcgcctgggacgagggccaccccccgccgggcccccaggacccc
gaggacgtggtgacgctggaggcaacgtgctga

KEGG   Felis catus (domestic cat): 105261394
Entry
105261394         CDS       T02385                                 
Symbol
IL3RA
Name
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105261394 (IL3RA)
   04151 PI3K-Akt signaling pathway
    105261394 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105261394 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105261394 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105261394 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105261394 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    105261394 (IL3RA)
   04090 CD molecules [BR:fca04090]
    105261394 (IL3RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   105261394 (IL3RA)
CD molecules [BR:fca04090]
 Proteins
  105261394 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 105261394
NCBI-ProteinID: XP_023104654
LinkDB
Position
X:1030029..1055668
AA seq 395 aa
MAFLWLALCLTPACCLLHKDEDPEPPIKNLRMQPETRRLTWDLSGNVSEISCFINSRLIT
KAVDKPYCQFRVLPTCQVTNFTVASTGDPPFSAGILYPRPEGHPEAAAQRLGCWVHDVDF
LTCSWEAGRAAPGDVQYRLYWQDLKTYEEEECPRYGVDDRGTHIRCHFDDVSRLREHVQF
LVKGTSRGARIPCSDLTVELARIERLSLPNITGMCNKSYSIMEWKMSSHFNHRFTYELEI
QKGSDPAYTEKAPGSYFVLPNPGNYAVRLRAHARFRQTWSEWSAVRRFGLGSFQEEKLRT
QTRAEGRPECDLGKDTHFRDWLTSALIPLGALLALGLGVALCRRYSVLQKLFPPIPHLKD
PISDNLHSSKLVAWEASRASREDCQVAEVQVLGET
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccttcctgtggctggccttgtgtctcacgcccgcgtgctgtctgctgcacaaggac
gaagatcccgagccgccgattaagaacctgcgaatgcagcccgagacgagaaggttgacc
tgggacctcagcggaaacgtgtctgagatcagctgtttcatcaactcgaggctgatcact
aaggccgtggacaagccttactgccagttccgcgtacttcccacgtgtcaggtgacgaat
ttcacggtcgcctccaccggagacccgccgttctccgcagggatcctgtaccccaggcca
gagggccaccctgaggcggccgcgcagcgtctgggctgctgggtgcacgacgtggacttc
ctgacgtgcagctgggaggcgggccgcgcggcccccggtgacgtccagtatcgcctgtac
tggcaggacctcaagacctacgaggaggaggagtgtccccggtacggggtggacgatcgg
gggacacacatccggtgtcatttcgacgacgtgtcccggctcagggaacacgtccagttc
ctggtgaagggcaccagcaggggcgcgaggatcccctgctccgacctcactgtggaactg
gcaagaatcgagagattaagtctgcccaacatcaccggaatgtgtaataaatcctattca
atcatggagtggaaaatgtcaagccactttaatcacagatttacatacgaacttgaaata
caaaagggctcagatcccgcctacaccgagaaggcgcccggcagctacttcgtgctcccc
aatcccggaaactacgcggtgaggctgagggcgcacgcgcgcttccgccaaacctggagc
gagtggagcgccgtccggcgctttggactggggtcctttcaagaagagaagttgaggaca
cagacacgcgcagagggacggccagagtgcgacctcgggaaggacacgcacttccgagac
tggctgacctccgctctgatcccgctgggcgcgctgctggccctggggctgggggtcgcg
ctgtgccgaaggtactcggtgctgcagaagctcttccccccgatcccgcacctgaaggac
cccatcagtgacaacctgcacagcagcaagttggtggcctgggaggccagcagagcaagc
cgggaggactgccaggtggcggaggtgcaggttctgggagaaacgtga

KEGG   Felis catus (domestic cat): 493953
Entry
493953            CDS       T02385                                 
Symbol
IL2RA
Name
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493953 (IL2RA)
   04151 PI3K-Akt signaling pathway
    493953 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493953 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    493953 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    493953 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493953 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    493953 (IL2RA)
   04659 Th17 cell differentiation
    493953 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493953 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493953 (IL2RA)
   05162 Measles
    493953 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    493953 (IL2RA)
   04090 CD molecules [BR:fca04090]
    493953 (IL2RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   493953 (IL2RA)
CD molecules [BR:fca04090]
 Proteins
  493953 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100
Other DBs
NCBI-GeneID: 493953
NCBI-ProteinID: NP_001009355
Ensembl: ENSFCAG00000005794
UniProt: P41690
LinkDB
Position
B4:complement(5444091..5499655)
AA seq 275 aa
MEPSLLLWGILTFVVVHGHVTELCDENPPDIQHATFKALTYKTGTMLNCECKKGFRRISN
GSAFMLCAGNSSHSSWENQCRCISTSPRATDGQIIPKPEEQKGKSPMGMQSQMQPTDQVN
LPGHCREPPPWEHEDSRRIYHFVVGQTVHYQCMQGFRALKRGPAKSVCKTTCGKATWTQP
RLQCLSERSDGWFPDDEEPQASTDAALGSDTSCPSITASTTDFQRHTEVAMTTESFVFTT
EYQIAVAGCVLLLISIVLLSGLTWQRRWRKSRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaagcctgctgctgtggggaatcctcacattcgtcgtggtacatggccacgtg
acagaactgtgtgatgaaaacccgccagatatccaacacgccacattcaaagccctcaca
tacaagacgggcaccatgttaaattgtgaatgtaagaagggcttccgcagaataagcaac
gggtcagccttcatgctgtgtgcaggaaactcgagccactcctcctgggaaaaccaatgc
cggtgcataagtacctccccaagggccacagatggacaaattatccctaaacctgaagaa
cagaagggaaaaagccccatgggaatgcagagccaaatgcagcccacggaccaagttaac
cttccaggtcactgcagggagcctccgccctgggaacatgaagattcgaggagaatttac
cattttgtggtggggcagacagttcactaccagtgcatgcagggattcagggccctgaag
aggggtcctgccaagagtgtctgcaaaacgacctgtgggaaggcaacgtggacacagccc
cgactccagtgcctaagcgaaaggagtgatggctggtttccggatgacgaagagcctcaa
gccagcactgatgctgctcttgggagtgacacttcctgtccctcaataacagcaagtact
acagatttccagagacatacggaagtggctatgaccacggagtcattcgtattcacaacc
gagtatcagatagcagtggccggctgcgtcctcctgctgatcagtatcgtccttctgagc
gggctcacctggcagcggagatggaggaagagtagaagaacaatctag

DBGET integrated database retrieval system