Felis catus (domestic cat): 101080257 Help Entry 101080257         CDS       T02385                                  Symbol MACROH2A1 Name (RefSeq) core histone macro-H2A.1 isoform X5   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101080257 (MACROH2A1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101080257 (MACROH2A1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080257 (MACROH2A1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101080257 (MACROH2A1)   09165 Substance dependence    05034 Alcoholism     101080257 (MACROH2A1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080257 (MACROH2A1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080257 (MACROH2A1) Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080257 (MACROH2A1) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080257 (MACROH2A1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N Motif Other DBs NCBI-GeneID:  101080257 NCBI-ProteinID:  XP_023111195 LinkDB All DBs Position A1:complement(111843933..111923152) Genome browser AA seq 372 aa AA seqDB search MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPA DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKE FVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIG IYVQEMAKLDAN NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt atgtcgagccggggtgggaagaagaaatctaccaagacctcccggtccgccaaggcggga gtcatcttccccgtggggcggatgctgcggtacatcaagaaaggccaccccaagtacagg attggagtgggggcacccgtgtacatggctgccgtcctggagtatctgacagctgagatt ctggagctggctggcaacgcagcaagagacaacaagaaggggcgggtcaccccccggcac atcctgctggccgtggccaacgacgaagagctaaatcagctgctaaaaggagtcaccata gccagtgggggagtgttaccaaacatccatccggagttgctagcaaagaaacgaggatcc aaagggaagttggaagccatcatcacaccacccccagccaaaaaggccaagtctccatcc cagaagaagcccgtgtctaagaaagcaggaggcaagaaaggggctcggaaatccaagaag aagcagggcgaagtcagcaaggcagccagcgccgacagcaccaccgagggaacgccggcc gatggcttcacagtactctccaccaagagcctcttcctcggccagaagctgaaccttatt cacagtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaat gctgacattgaccttaaagatgacctaggaaacacgctggagaagaaaggtggcaaggag tttgtggaagctgttctggaactccgaaaaaagaacgggcccttggaagtagctggagct gctgtcagtgcaggtcacggcctgcctgccaagtttgtgatccactgtaacagtccggtc tggggtgccgacaagtgtgaggaacttctggaaaagacggtgaagaactgtctggccctg gcagacgataagaagctcaagtccatcgcgttcccgtccattggcagcggcaggaatggc tttccaaagcagacggcagctcagctgattctgaaggccatctccagttacttcgtgtca acgatgtcctcttccatcaaaacggtgtatttcgtgctttttgacagcgagagtataggc atctacgtacaagaaatggccaagctggacgccaactag

Felis catus (domestic cat): 101080814 Help Entry 101080814         CDS       T02385                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101080814  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101080814  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080814  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101080814   09165 Substance dependence    05034 Alcoholism     101080814  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080814   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080814 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080814 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101080814 NCBI-ProteinID:  XP_003990605 LinkDB All DBs Position C1:104693350..104693853 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcgcggaaagcagggaggcaaggcccgcgctaaggctaagtcgcgctcgtcc cgcgccggcctgcagttcccggtgggccgagtgcaccgcctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgccggtctacatggcggcggtgctggagtatctgacg gcggaaatcctggagctggcggggaacgcggcccgcgacaacaagaagacgcgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggaactgaacaagctgttgggcaaa gtcaccatcgcccagggcggcgtgctgcctaacatccaggccgttctcttaccaaagaaa acagaaagccacaaagccaaaagcaaataa

Felis catus (domestic cat): 101081066 Help Entry 101081066         CDS       T02385                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101081066  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101081066  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101081066  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101081066   09165 Substance dependence    05034 Alcoholism     101081066  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101081066   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101081066 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101081066 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101081066 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101081066 NCBI-ProteinID:  XP_003990606 LinkDB All DBs Position C1:complement(104693964..104694427) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagcagggaggcaaagctcgcgccaaggccaagtcgcgctcgtcc cgcgccggcctgcagttcccggtgggccgcgtgcaccgcctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggcggtgctggagtacctgacg gcggaaatcctggagctggcggggaacgcggcccgcgacaacaagaagacgcgcatcatc cctcgccatttgcagctagccgtgagaaatgacgaagagctcaacaagttactcgggggt gtcaccattgcccagggcggcgtcttgcccaatatacaggcggtcttgttgcccaagaaa acggagagtcacaagcctggcaagaacaagtaa

Felis catus (domestic cat): 101083005 Help Entry 101083005         CDS       T02385                                  Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101083005  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101083005  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101083005  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101083005   09165 Substance dependence    05034 Alcoholism     101083005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101083005   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101083005 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101083005 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101083005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101083005 NCBI-ProteinID:  XP_011280368 UniProt:  M3X726 LinkDB All DBs Position B2:complement(2727507..2727958) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcgggaagcagggtggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagggcaaataa

Felis catus (domestic cat): 101083265 Help Entry 101083265         CDS       T02385                                  Name (RefSeq) histone H2A type 1-J   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101083265  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101083265  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101083265  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101083265   09165 Substance dependence    05034 Alcoholism     101083265  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101083265   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101083265 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101083265 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101083265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101083265 NCBI-ProteinID:  XP_023110466 Ensembl:  ENSFCAG00000043173 LinkDB All DBs Position B2:2744937..2746099 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKTKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtcaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaagaccaagggcaagtag

Felis catus (domestic cat): 101084707 Help Entry 101084707         CDS       T02385                                  Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101084707  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101084707  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084707  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101084707   09165 Substance dependence    05034 Alcoholism     101084707  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084707   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101084707 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084707 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101084707 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101084707 NCBI-ProteinID:  XP_003985740 Ensembl:  ENSFCAG00000040930 UniProt:  M3X726 LinkDB All DBs Position B2:2762736..2763650 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccataaggccaaggggaaatag

Felis catus (domestic cat): 101085206 Help Entry 101085206         CDS       T02385                                  Name (RefSeq) histone H2A type 1-E-like   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101085206  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101085206  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101085206  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101085206   09165 Substance dependence    05034 Alcoholism     101085206  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101085206   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101085206 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101085206 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101085206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101085206 NCBI-ProteinID:  XP_003985742 Ensembl:  ENSFCAG00000051396 UniProt:  M3X700 LinkDB All DBs Position B2:complement(2767234..2768152) Genome browser AA seq 128 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaagccaagtga

Felis catus (domestic cat): 101085975 Help Entry 101085975         CDS       T02385                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101085975  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101085975  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101085975  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101085975   09165 Substance dependence    05034 Alcoholism     101085975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101085975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101085975 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101085975 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101085975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101085975 NCBI-ProteinID:  XP_003985820 LinkDB All DBs Position B2:complement(4069485..4070058) Genome browser AA seq 141 aa AA seqDB search MVHEALAVSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLA AVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVLPNIQAVLLPKK TESHRHKVQSKQCLTSSKSSK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggtacatgaggctttggctgtgtctgggcgcgggaagcagggcggcaaggctcgcgcc aaggccaagacgcgctcgtcgcgggccgggctgcagttcccggtgggccgcgtgcaccgc ctgctccgcaagggcaactacgccgagcgggtgggggccggcgcgccggtgtacctggcg gccgtgctggagtacctgacggccgagatcctggagctggcgggcaacgcggcccgcgac aacaagaagacgcgcatcatcccgcgccacctgcagctggccatccgcaacgacgaggag ctcaacaagctgctgggccgcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccgccacaaagtccagagcaagcaatgtctcacaagcagtaaatccagc aagtga

Felis catus (domestic cat): 101086721 Help Entry 101086721         CDS       T02385                                  Name (RefSeq) histone H2A type 1-H-like isoform X1   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101086721  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101086721  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101086721  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101086721   09165 Substance dependence    05034 Alcoholism     101086721  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101086721   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101086721 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101086721 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101086721 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  101086721 NCBI-ProteinID:  XP_003985748 Ensembl:  ENSFCAG00000046013 UniProt:  M3WY36 LinkDB All DBs Position B2:complement(3257989..3269975) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKSK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagcaaggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtgggccgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtcaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggctaagagcaagtag

Felis catus (domestic cat): 101087401 Help Entry 101087401         CDS       T02385                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism fca  Felis catus (domestic cat) Pathway fca03082   ATP-dependent chromatin remodeling fca04217   Necroptosis fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101087401  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101087401  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101087401  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101087401   09165 Substance dependence    05034 Alcoholism     101087401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101087401   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101087401 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101087401 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101087401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101087401 NCBI-ProteinID:  XP_023108679 Ensembl:  ENSFCAG00000039458 LinkDB All DBs Position B1:121723951..121726212 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctgggaaggactccggaaaggccaagacaaaggcggtttcccgc tcgcagagagccggcttgcagttcccggtgggccgtattcatcgacacctgaaatctagg acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgaattggcaggaaatgcatcaaaagacttgaaggtaaag cgtattactcctcgtcacttgcaacttgctattcgtggagatgaggaattggattctctc atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg aagaaaggacaacagaagactgtttaa

DBGET integrated database retrieval system