Felis catus (domestic cat): 101080314 Help Entry 101080314         CDS       T02385                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080314  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101080314   09163 Immune disease    05322 Systemic lupus erythematosus     101080314   09165 Substance dependence    05034 Alcoholism     101080314  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080314   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080314 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080314 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101080314 NCBI-ProteinID:  XP_019694662 LinkDB All DBs Position C1:104655620..104656613 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccggcaaagtccgcccccgcggccaagaagggctcgaagaaggcggtcacc aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtcaacgacatctttgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

Felis catus (domestic cat): 101080561 Help Entry 101080561         CDS       T02385                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101080561  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101080561   09163 Immune disease    05322 Systemic lupus erythematosus     101080561   09165 Substance dependence    05034 Alcoholism     101080561  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101080561   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101080561 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101080561 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101080561 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101080561 NCBI-ProteinID:  XP_003990604 LinkDB All DBs Position C1:complement(104692637..104693131) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcaaaatccgctcccgcgcccaagaagggctcgaaaaaggcggtcacc aaagcccagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacactggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaatgacatctttgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcaaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

Felis catus (domestic cat): 101082235 Help Entry 101082235         CDS       T02385                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101082235  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101082235   09163 Immune disease    05322 Systemic lupus erythematosus     101082235   09165 Substance dependence    05034 Alcoholism     101082235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101082235   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101082235 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101082235 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101082235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101082235 NCBI-ProteinID:  XP_003985731 UniProt:  M3X6T1 LinkDB All DBs Position B2:complement(2705882..2706322) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

Felis catus (domestic cat): 101083514 Help Entry 101083514         CDS       T02385                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101083514  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101083514   09163 Immune disease    05322 Systemic lupus erythematosus     101083514   09165 Substance dependence    05034 Alcoholism     101083514  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101083514   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101083514 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101083514 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101083514 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101083514 NCBI-ProteinID:  XP_023110467 LinkDB All DBs Position B2:complement(2744130..2744686) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgccccggccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgcaaagtga

Felis catus (domestic cat): 101084446 Help Entry 101084446         CDS       T02385                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101084446  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101084446   09163 Immune disease    05322 Systemic lupus erythematosus     101084446   09165 Substance dependence    05034 Alcoholism     101084446  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101084446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101084446 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101084446 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101084446 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101084446 NCBI-ProteinID:  XP_003985739 UniProt:  M3X6T1 LinkDB All DBs Position B2:complement(2761902..2762465) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgccccggccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

Felis catus (domestic cat): 101085463 Help Entry 101085463         CDS       T02385                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101085463  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101085463   09163 Immune disease    05322 Systemic lupus erythematosus     101085463   09165 Substance dependence    05034 Alcoholism     101085463  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101085463   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101085463 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101085463 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101085463 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101085463 NCBI-ProteinID:  XP_003985743 UniProt:  M3X6T1 LinkDB All DBs Position B2:2768419..2768889 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtag

Felis catus (domestic cat): 101086477 Help Entry 101086477         CDS       T02385                                  Name (RefSeq) histone H2B type 1-K   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101086477  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101086477   09163 Immune disease    05322 Systemic lupus erythematosus     101086477   09165 Substance dependence    05034 Alcoholism     101086477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101086477   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101086477 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101086477 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101086477 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101086477 NCBI-ProteinID:  XP_044914451 LinkDB All DBs Position B2:3258735..3260394 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggccaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgcgaagtaa

Felis catus (domestic cat): 101086971 Help Entry 101086971         CDS       T02385                                  Name (RefSeq) LOW QUALITY PROTEIN: histone H2B type 1-J   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101086971  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101086971   09163 Immune disease    05322 Systemic lupus erythematosus     101086971   09165 Substance dependence    05034 Alcoholism     101086971  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101086971   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101086971 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101086971 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101086971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101086971 NCBI-ProteinID:  XP_023105366 Ensembl:  ENSFCAG00000046482 LinkDB All DBs Position B2:3270223..3270652 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSXGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggaaccagcgaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaagcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctattccatc tacgtgtacaaggtactgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccngaggcaccaaggccgtcacc aagtacaccagcgccaagtga

Felis catus (domestic cat): 101088485 Help Entry 101088485         CDS       T02385                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101088485  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101088485   09163 Immune disease    05322 Systemic lupus erythematosus     101088485   09165 Substance dependence    05034 Alcoholism     101088485  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101088485   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101088485 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101088485 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101088485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101088485 NCBI-ProteinID:  XP_003985755 UniProt:  M3X6T1 LinkDB All DBs Position B2:complement(3621855..3625132) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagcgaagtccgctcccgccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaaacgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcctggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aaatacaccagctccaagtag

Felis catus (domestic cat): 101088681 Help Entry 101088681         CDS       T02385                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism fca  Felis catus (domestic cat) Pathway fca04613   Neutrophil extracellular trap formation fca05034   Alcoholism fca05203   Viral carcinogenesis fca05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101088681  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101088681   09163 Immune disease    05322 Systemic lupus erythematosus     101088681   09165 Substance dependence    05034 Alcoholism     101088681  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101088681   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101088681 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101088681 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101088681 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101088681 NCBI-ProteinID:  XP_019693319 LinkDB All DBs Position C1:complement(104665684..104666373) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccggcaaagtccgcccccgcggccaagaagggctcgaagaaggcggtcacc aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaggagagttactccatc tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtcaacgacatctttgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctcgaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system