KEGG   Felis catus (domestic cat): 101080367
Entry
101080367         CDS       T02385                                 
Symbol
LAMB1
Name
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101080367 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101080367 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101080367 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101080367 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101080367 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101080367 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101080367 (LAMB1)
   05145 Toxoplasmosis
    101080367 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA ATG17_like F5_F8_type_C
Other DBs
NCBI-GeneID: 101080367
NCBI-ProteinID: XP_006929172
Ensembl: ENSFCAG00000004478
UniProt: M3W292
LinkDB
Position
A2:78534785..78609303
AA seq 1786 aa
MGLLQVFAFSFLALCGAQVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCEGSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGINEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVSGG
VCDDCQHNTMGRNCEQCKPFYFQHPERDVRDPHLCERCTCDPAGSENGGICDSYTDFSAG
LIAGQCRCKLHVEGEHCELCKEGFYGLSAEDPFGCKSCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSPESGQCACRPHVIGRQC
NEVESGYYFTTLDHYIYEAEEANFGPGVSIVERQYVQDRIPSWTGAGFVRVPEGAYLEFF
IDNIPYSMEYDILIRYEPQLPDRWEKAVIMVQRPGKIPTSSRCGNTIPDDDNQVVSLSPG
SRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSDLESPYTLIDSLVLMPFCKSLDIFTVGG
SGDGLVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCKPCECHLQGSVNAFCDPITGQC
HCFQGVYARQCDRCLPGYWGFPSCQPCQCNGHADDCDSATGACSGCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFANSCYQDPVTLQLACVCNPGYVGSRCDDCAS
GFFGNPSDVGGSCQPCECHGNIDTTDPEACDRETGRCLKCLYHTEGDQCQLCRLGYYGDA
LRQDCRKCVCNYLGTVQDHCNGSDCQCDKTTGQCSCLPNVVGQNCDRCAPNTWQLASGTG
CDPCSCDPAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECRACDCDPRGIE
TPQCDQSTGRCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFAVWDVIVAELTNRTQKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIRDILAQSPATEPLKNIGDLFEEAEKLTKDV
TDKMAQVEVKLSDTASQSNSTARELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDS
ITKYFQMSLEAEERVNASTTDSNSTVDQSTLTRDRVEELLLERESQFREKQEEQARLLDE
LAGKLQSLDLSAVAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLQKTNATKEKVDKSNEDL
RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPEQLQNLTEDIRERVESLSQVEVI
LQQSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQIAAEKAIKQADEDI
QGTQNLLTSIESETAASEENLLNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK
QSADDVKKALDGEVDEKYKKVEKLIAQKTEESADARRKAEMLQNEAKTLLAQANSKLQLL
KDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggctgctccaggtgttcgctttcagtttcttagccctgtgcggagcccaagtgcgc
gctcaagaacctgaattcagctacggctgcgcggagggcagctgctaccccgccactggc
gaccttctcatcggccgagcacaaaagctctcggtgacctcgacgtgcgggctgcacaag
cctgagccctactgtattgtcagccacctccaggaggacaaaaaatgcttcatatgcaat
tcacaagatccttatcatgagaccctcaatcctgacagtcatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatccgaaaatggcgtggaaaac
gtaactatccaactggatctggaagcagaattccattttactcatctcataatgactttc
aagacattccgtccggccgcgatgctgatagaacgatcgtctgacttcgggaaaacctgg
ggtgtgtacagatactttgcctatgactgtgagggctcatttccaggcatttcaactggc
cccatgaaaaaagtggatgatataatctgtgattcccgctattctgacattgaaccctcg
acggaaggagaggtgatatttcgtgctttagatcccgcgttcagaatagaagatccttat
agtccgaggatacagaatctcttaaaaatcaccaacttgagaatcaagtttgtgaagctc
cacactttgggagataaccttttggattcccggatggaaatcagggaaaagtattactat
gcagtttatgatatggtggttcgaggaaattgcttctgctacggtcatgccagcgaatgc
gcccctgtggatggaatcaatgaagaagtagaaggaatggttcatgggcactgcatgtgc
aggcataataccaagggcttaaactgtgaactgtgcatggatttctaccacgatttacct
tggagacccgctgaaggtcgaaacagcaatgcctgtaaaaagtgtaactgcaatgaacat
tcgagctcgtgccactttgacatggccgtgtacttggccaccggcaatgtcagcggaggg
gtgtgtgatgactgtcagcacaacaccatgggacgcaactgtgaacagtgcaagccgttt
tacttccagcacccggagagagacgtccgagaccctcacctctgtgaacgatgtacctgt
gacccagctggatctgagaatgggggaatctgtgacagttacaccgatttttctgctggc
ctcattgccggccagtgtcggtgtaaattacacgtggaaggagaacattgtgaactctgc
aaagagggcttctacggcttaagtgctgaagatccatttggttgtaaatcttgtgcctgc
aatcctctgggaacgattcccggcgggaatccttgtgattctgagactggttactgctac
tgcaagcgtctggtgacaggacagcattgtgaccagtgtctgccggagcactggggcttg
agcaatgatttggatggatgtcgaccttgtgactgtgaccttggaggggctttaaacaac
agctgttcccctgaatcgggccagtgcgcgtgccgaccgcacgtgatcgggcgtcagtgc
aacgaagtggagtctggttactacttcaccaccttggatcactacatctacgaagcagaa
gaagccaactttgggcccggggtcagcatcgtggagcggcagtacgttcaagaccggatt
ccttcctggacgggagccggcttcgtccgagtgcctgaaggggcttatttggagtttttc
attgacaacataccatattccatggagtatgacatcttaattcgctatgagccacagctc
cccgaccgctgggaaaaagctgtcatcatggtgcagcgacctggaaagatcccaaccagc
agccgatgcggtaataccattcccgatgatgacaaccaggtggtgtccttatcgcctggc
tcaaggtatgtcgtccttccgcgccccgtgtgctttgagaagggtgtgaattacacggtg
aggttagagctgcctcagtacacatcctccgacagcgacctggagagtccctacacgctt
atcgactcccttgttctcatgccgttttgtaaatccctggatatcttcaccgtgggagga
tcaggggacgggttggtcaccaacagcgcctgggaaacctttcagagatacagatgtctg
gagaacagcagaagcgttgtgaaaacaccaatgaccgacgtgtgcagaaacataatcttc
agcatttctgccctgttacaccagacaggcctggcttgtgaatgtgacccccagggctcc
ttaagttccgtctgcgatcccaatggagggcagtgccagtgccggcccaacgtggttgga
agaacctgcgacagatgtgccccgggcaccttcggctttggccccagtggctgcaaacct
tgtgagtgccacctgcaagggtccgtcaacgctttctgcgaccccatcactggccagtgc
cactgcttccagggggtgtatgctcggcagtgtgaccggtgcttgcccggctactggggc
ttccccagctgccagccctgccagtgtaacggccacgccgacgactgtgactctgccacc
ggggcgtgctcaggctgccaggactacaccacggggcacaactgtgaaaggtgcttggcc
ggttactatggcgatcccatcattgggtcaggagatcactgccgcccttgtccttgccca
gatggtcccgacagtggacgccagttcgccaatagctgctatcaagatcctgttacttta
cagcttgcctgtgtctgtaatcccggatacgttggctccagatgtgacgactgtgcctca
ggcttctttggcaatccctcggacgtggggggctcctgtcagccttgcgagtgtcacggc
aacattgacacgacggacccggaagcctgtgacagggagaccggaaggtgccttaagtgc
ctgtaccacacggaaggggatcagtgccagctctgccgactcgggtactatggggacgcg
ctccgccaggactgtcgaaaatgtgtctgcaattacctgggcaccgtgcaggaccactgc
aacggctctgactgccagtgtgacaaaaccaccggtcagtgctcgtgtctccctaatgtg
gtcgggcagaactgtgaccgctgtgcgcccaacacctggcagctggccagcgggaccggg
tgtgacccgtgcagctgtgatcccgctcattcctttgggccatcttgcaatgagttcaca
gggcagtgccagtgcatgcctgggttcggaggccgcacctgcagcgagtgccaggagctc
ttctggggagaccctaacgtggagtgccgagcctgtgactgtgaccccagaggcatcgag
acaccacagtgtgaccagtccaccggccggtgcgtctgcgtggagggtgtcgagggcccg
cgctgtgacaaatgcacacgcgggtactcgggggtcttccccgactgcactccctgccac
cagtgctttgccgtgtgggatgtgatcgtcgccgagttgaccaatcggacccagaagttc
ctggagaaagccaaggccctgaagatcagcggcgtgattgggccttaccgggagactgtg
gactcggtggagaagaaagtgaatgagatcagagacatcctggcccagagcccagccacg
gagccactgaagaacatcggggatctctttgaggaagcagagaaattaaccaaagatgtt
acagacaagatggctcaagtagaagtgaaattgtctgacacagcttcccaaagcaacagc
acggccagagaactagattctctacagacagaagcagaaagcctagacaacacagtgaaa
gagcttgctgagcagttggaatttatcaaaaactcagatattcggggcgccttggatagc
atcaccaagtatttccagatgtctctagaggcagaggagagggtgaacgcctccaccaca
gattccaacagcactgtggaccagtcgactctcactcgggacagagtagaagagttgttg
ttggaacgagaatcccagttcagggaaaaacaagaggaacaggcccgccttctggatgaa
ctggcaggcaaactacagagtctagacctttcagccgttgccgagatgacctgtgggacg
cctccgggggcctcttgttccgagaccgagtgtggcggcccgaactgcaggactgacgaa
ggagagaagaagtgtgggggacccggctgcggcggcctggtcacggtcgcccacagtgcc
tggcagaaagccatggactttgaccgcgatgtcctgagcgccctggccgaggtggagcag
ctctccaagatggtctctgaagcgaaactgagggcagacgaggcaaaacaaaatgctcag
gatgttctgcagaaaaccaatgccaccaaagaaaaagtggacaagagcaatgaggacctg
agaaatctgatcaagcaaatccgaaactttttgacccaggatagtgctgatttggacagc
attgaagcagttgctaatgaagtgctgaaaatggaaatgcccagcaccccagagcagtta
cagaacttgacagaagacattcgggagcgagttgaaagcctttctcaagtagaggttatt
ctacagcaaagcgctgctgacattgccagagcggagatgttgctagaagaagctaaaaga
gccagcaaaagtgcaactgatgttaaagtcactgcagacatggtcaaggaggctctggag
gaagcagaaaaggcccagattgcagcagagaaagcaattaaacaagcagatgaagacatc
cagggaacccagaacctactgacttcgattgagtcggaaacagcggcttcggaggagaac
ttgctcaacgcctcccagcgcatcagcgagcttgagaggaatgtggaagaactgaaacgg
aaggctgcccagaactctggggaggcagaatatattgagaaagtagtatacaccgtgaaa
caaagtgcggatgatgttaagaaggctctggacggtgaagttgatgaaaagtataagaaa
gtagaaaaattaattgcccaaaaaactgaagagtcagctgatgccagaagaaaagctgaa
atgctacaaaatgaagcaaaaacacttttggctcaagcaaacagcaagctgcagctcctg
aaagatttagaaagaaaatatgaggacaatcaaaaatatttagaagataaagctcaagaa
ttagtaagactggaaggagaagtccgttcgctcctcaaggatataagccagaaagttgct
gtttacagcacctgcttgtaa

KEGG   Felis catus (domestic cat): 101082047
Entry
101082047         CDS       T02385                                 
Symbol
LAMB2
Name
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101082047 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101082047 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101082047 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082047 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101082047 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101082047 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101082047 (LAMB2)
   05145 Toxoplasmosis
    101082047 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 101082047
NCBI-ProteinID: XP_003982265
Ensembl: ENSFCAG00000009848
UniProt: M3WC88
LinkDB
Position
A2:complement(18249069..18260590)
AA seq 1801 aa
MERASWVSGRDLRGLPGPWELRLGLLLSALATALAQALAPDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAPG
APVHAEGMVHGACICKHNTRGLNCERCQDFYHDLPWRPAEDGHSHACRKCECHGHAHSCH
FDMAIYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGS
QDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGFFGLSASDPAGCRRCQCDARGT
VPGITSCDPNSGTCFCKRLVTGRGCNRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCNEA
TGQCRCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGGTVSWTGR
GFVRLQEGQALEFLVTSVPRAMDYDLLLRLEPQVPEQWAEMEVAVQRPGPVSAHGPCGHM
LPKDDHIPGTLQPETRYMVFPRPVCLEPGISYKLHLKLVRTGGSAQPEAPYSRPSLLIDS
LVLLPRVLVLEMFSGGDAAALERRATFEHYRCHEEGLVPSKTLPSEACVPLLISLSALLY
NGALPCQCDPQGSLSSECNPHGGQCLCKPAVVGRRCDRCAPGFYGFGPTGCQACQCSPEG
ALSGLCEGTSGQCPCRAGAFGLRCDRCQRGQWGFPNCQPCVCNGHADECDTHTGTCLGCR
DHTGGEHCERCIAGFHGDPRLPHGGQCRPCPCPEGPGSRRHFATSCHRDGYSQQIMCHCK
AGYTGLRCEACAPGHFGDPSRPGGQCQPCECSGNIDPTDPDACDPRTGQCLRCLYHTEGP
HCAHCKPGFHGQATRQSCHRCTCNLLGTDPQQCPSTDRCHCDPSSGQCPCLPNVQGPSCD
RCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHCRAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHTCFGDW
DRVVQDLAARTRRLEQRAQELQQTGVLGAFESRFWHMQEKLGTVQGIVGTRNTSAASTAQ
LVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSSLERDGLALNLTLRQLDQH
LDLLKHSNFLGAYDSIRHAHSLSAEAERRANTSALTVPSPVSNSADTRHRTEVLIGAKKE
DFNRKHMANQQALGELSARTQSLSLTGINELVCGPPGDAPCATSPCGGAGCLDEDGQPRC
GGLSCNGAVAMADLALGRARHTQAELQRALAEGGGILSQVAETRRQAGEAQQRAQAALDK
ANASRGQVEKANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQHLAG
AIAERVQSLADVDTILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRA
QGAAQGAIQGAVVDTQDTERTLHQVQEKMAGAEQALSSAGERAQQLDGLLEALKLKRAGN
SLAASSAEETAGSAQGRAREAEQLLQGPLGDQYQTVKALAERKAQGVLAAQARAEQLRDE
ARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTC
Q
NT seq 5406 nt   +upstreamnt  +downstreamnt
atggagcgggcctcatgggtatcagggagggacctgcggggactgcctgggccctgggag
cttcgactgggcctgctgctgagtgcgctggccaccgccctggcccaggccctggcccca
gatgtgccaggctgttcgaggggaagctgctaccccgccacaggtgacctgctagtgggc
cgtgctgacagactgactgcctcatccacctgtggcttgcatggcccccagccctactgc
atcgttagtcaccttcaggatgagaagaagtgcttcctgtgtgattcccggcgccccttc
tctgctagagacaacccaaacagtcatcgcatccagaatgtagttaccagctttgcacca
cagcgccggacagcctggtggcagtcagagaatggtgtccccgtggtcaccatccagctg
gacttggaggctgagtttcatttcacacacctcattatgaccttcaagacatttcgtcct
gctgccatgctggtggagcgctcagcagactttggacgcacctggcatgtgtaccgatat
ttttcctatgactgtggggctgactttccaggagtcccactggcccccccacggcactgg
gatgacgtagtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtc
atctatcgtgtgctggatcctgccatccctatcccagacccctacagcccacggatccag
aacctgctgaagatcactaacctacgggtgaacctgacacggctgcatacactgggggac
aacctgcttgacccacgacgggagatccgtgagaaatactattatgccctctacgagctg
gttgtgcgtggcaactgcttctgttacggacacgcctcacagtgtgcacccgccccagga
gcaccagtgcatgctgagggcatggttcatggggcctgcatctgcaaacataacactcgt
ggcctcaactgtgagcggtgtcaagatttctatcatgacctgccctggcgtccggctgaa
gatggccacagtcatgcctgcaggaagtgtgagtgccatgggcatgcccacagctgccac
ttcgacatggccatatatctggcatctggcaacgtaagtggaggtgtgtgtgatggatgt
cagcacaacacagctgggcgccactgtgagctctgccgacccttcttctaccgtgaccca
accaaggacctgcgggaccctgctgtgtgccgctcctgtgattgtgaccccatgggttct
caagatggtggtcgctgtgatccccatgatgatcctgctctggggctggtctcgggccag
tgtcgctgcaaagaacatgtggtgggctctcgctgccagcaatgccgtgatggcttcttt
gggctcagtgccagcgaccctgcaggctgtcggcgatgtcagtgtgatgcacggggcaca
gtgcctgggatcacctcttgtgaccccaacagtggaacctgtttctgcaagcgtctagtg
actggacgtggctgcaaccgctgcttgcctggccattggggcctgagccacgacctgctt
ggctgccgtccatgtgattgcgacgtgggtggtgccttggatccccagtgcaatgaggcc
acaggtcagtgccgctgtcgccagcacatggtggggcgacgctgtgagcaggtgcagcct
ggctacttccggcctttccttgaccacctaacttgggaggctgaggacacccgaggacag
gtgctggatgtggtggagcgcctggtgacccctggtgggactgtatcctggacaggccgg
ggctttgttagactgcaggaaggtcaggcactggagttcctggtgacatctgtgccaaga
gccatggattatgatctgctgctgcgcttggagccccaggtccctgagcaatgggcagag
atggaagtggctgtgcagcgcccagggcctgtgtctgcccatggcccgtgtgggcacatg
ctgcccaaggatgaccacattccagggactctgcaaccagaaactaggtatatggtattt
ccaagacctgtctgccttgagcctggcatctcctataagctgcatctgaagctggtgcgg
acagggggaagtgcccagcctgaggccccctactctagacccagcctgctcattgactcg
ttggtgctgcttccccgtgtcctcgtgctggagatgtttagtgggggtgatgctgctgcc
ctggagcgccgtgccacctttgaacactaccgttgtcacgaggagggtctggtgcccagt
aagacccttccctctgaggcctgtgtccccctcctcatcagcctgtctgccctactctac
aatggtgccttgccctgtcagtgtgacccccagggctcactgagttctgagtgtaatccc
catggcggtcagtgcctgtgtaaacctgcagtggttgggcgccgctgtgatcgctgtgcc
cctggtttctacggctttggccccacaggttgtcaagcctgccagtgcagccccgagggg
gcactcagtggcctatgtgaagggaccagtgggcaatgcccctgccgagctggtgccttt
gggcttcgctgcgatcgctgccagcgtggccagtggggattccctaactgccagccatgt
gtctgcaatgggcatgcagatgaatgcgacacccacacaggcacttgcctgggctgccgt
gatcacacagggggtgagcactgtgaaaggtgcattgctggcttccacggggacccacgg
ctaccacatgggggccagtgccggccctgtccctgccctgaaggccctgggagccggcgg
cactttgctacttcttgccatcgggatgggtactcccagcagatcatgtgccactgtaag
gcaggctacacagggctgcggtgcgaagcttgtgcccctgggcactttggggacccatca
aggccaggtggccagtgccagccctgtgagtgcagtgggaacattgaccccacggaccct
gatgcctgtgacccccgcacggggcaatgcctgcgctgcttataccacacggaggggcca
cactgtgcccactgcaagcctggcttccatggacaggccacccgacagagctgtcaccgc
tgcacctgcaacttgctgggcacagatccccagcagtgcccgtccactgaccggtgccac
tgtgacccaagcagtgggcagtgcccatgcctccccaatgtccagggccctagctgtgac
cgctgtgcccccaacttctggaaccttaccagtggccatggatgtcagccctgtgcctgc
cacccaagccgagccagaggccctacctgcaatgagttcacagggcagtgccactgccgt
gctggctttggtgggcgaacctgttctgagtgccaggagctccactggggagaccctggt
ttgcagtgccgcgcctgtgattgtgaccctcgtggaatagacacacctcagtgtcaccgc
tccacgggccactgtagctgccgcccaggcgtgtctggcgtgcgctgtgaccagtgtgcc
cgtggcttctcaggggtctttcctgcttgccacccatgccacacatgcttcggggactgg
gaccgtgtggtacaggacttggctgcccgtacgcggcgcctggagcagcgggcacaggag
ctgcagcagacgggtgtgctgggtgcctttgagagccgcttctggcacatgcaggagaag
ctggggactgtgcaggggattgtgggtacccgcaacacctcagctgcctccactgcgcaa
cttgtggaggccacagaggagctacggcgtgaaattggggaggccactgagcacctgacc
cagctggaggcagaactgactgatgtgcaggatgagaacttcaatgccaaccatgcactg
agcagtctggagcgagatgggcttgcacttaatctcacactgcggcagctggaccagcat
ttggacctgctcaagcattcaaacttcctgggtgcctatgacagcatccgccatgcccac
agtctgtctgcagaggcggaacgtcgtgccaacacatcagccctgacagtgcccagtcct
gtgagcaactcagcagatacccggcacaggacagaggtgctaataggtgccaagaaggag
gacttcaaccgcaagcacatggccaaccagcaggcactaggcgagctctcagcccgtacc
cagtccctgagcctgacaggcatcaatgaactggtgtgtgggcccccaggggatgcaccc
tgtgcaacaagcccttgcgggggtgctggctgcctggacgaggatgggcaaccccgctgt
gggggcctcagctgcaatggggcagtagccatggcggacctggcactgggtcgggcccgg
cacacgcaggcagagctgcagcgggcactggcagaaggtggcggcatcctcagccaggtg
gctgagacccgtcggcaggcaggagaggcacagcagcgggcccaggcagccctggacaag
gctaatgcttccaggggacaggtggagaaggccaaccaagaacttcgggaacttatccag
agtgtgaaggacttcctcagccaggagggggctgatcctgatagcattgagatggtggcc
acacgagtgctagagctctccatcccagcatcacctgagcaaatccagcacctggcaggc
gcaattgcagagagggtccagagcctggcggatgtggacacaatcctggcacgcaccgtg
ggagatgtacgtcgggcagaacagctattgcaagatgcacggcgggcaaggagccgggct
gagggtgagaaacagaaggcagaaacagtacaagcagcactggaggaagcccagagggca
cagggagctgctcagggtgccatccaaggggcggtagttgacacacaggacactgagcgg
acactgcatcaggttcaggagaagatggcaggtgcagagcaggcactgagctctgcaggc
gagcgggctcagcaattggatggtcttctggaggctctgaaattgaaacgagcagggaat
agcctggcagcctctagtgcggaagaaacagcgggcagtgcccagggtcgtgcccgagag
gctgagcagctgctgcagggcccactaggcgaccagtaccaaacagtgaaggccttggct
gagcgcaaggcccagggtgtgttggctgcacaggcacgggcagagcaacttcgggatgaa
gctcgaggcttgttgcaggctgctcaggacaagctgcaacggctacaagagctggagggc
acctatgaagagaacgagcgggcactggaaggcaaagcagcccagctggatgggctggag
gccaggatgcgtagcgtgcttcaagccatcaacttgcaggttcagatctacaacacctgc
cagtga

KEGG   Felis catus (domestic cat): 101083299
Entry
101083299         CDS       T02385                                 
Symbol
LAMA1
Name
(RefSeq) laminin subunit alpha-1 isoform X2
  KO
K05637  laminin, alpha 1/2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101083299 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101083299 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101083299 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101083299 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101083299 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101083299 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101083299 (LAMA1)
   05145 Toxoplasmosis
    101083299 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101083299 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101083299 (LAMA1)
   05414 Dilated cardiomyopathy
    101083299 (LAMA1)
   05416 Viral myocarditis
    101083299 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_N Laminin_I Laminin_II Laminin_G_3 3keto-disac_hyd DUF5994 DUF948
Other DBs
NCBI-GeneID: 101083299
NCBI-ProteinID: XP_019670557
Ensembl: ENSFCAG00000008650
LinkDB
Position
D3:39166414..39336087
AA seq 3085 aa
MRGSGAGVALLASLLWVAARCQQRGLFPAILNLASNAHISTNATCGERGPEMSCKLVEHV
PGRPVRNAQCRICDADSANPKERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQV
FQVAYVIIKAANAPRPGNWILERSLDGTKFSPWQYYAVSDTECLTRYNITPRRGPPTYRA
DDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNA
DLMTLSHRDPKDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNT
CGESCNRCCPGYHQQPWRPGTISSGNTCEKCNCHNKAQDCYYDGNVANQRRSLNTAGQFR
GGGVCISCLQNTMGINCETCIDGYYRPHDVSPYDDNPCRPCDCDPFGSLSSVCIKDKPQS
GLHKGKWPGQCPCKEGYAGEKCDHCQFGYKGYPACVRCECSRAGGVNEDPCSEPCLCKEN
VEGENCDLCKPGFYNLKERNPEGCSECFCFGVSDVCDSLSWSISQVKDMSGWLVTDLISP
SKIPSQQDALGGRHQISINNTVATQRLTSKYYWSAPEAYLGNKLTAFGGFLKYTVSYDIP
VETVDGDLMSHTDVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFRDFNNKKEIDR
DQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDTASPNVIDLALATEVEHCECPQGYA
GISCESCLPGYYRVDGILFGGICQPCECHGHATECDIHGVCFACKHNTTGDHCEQCAPGF
YGLPSRGTPRDCQQCACPLSTASNNFSPTCHLEDGDEVVCDQCAPGYSGAWCERCADGYY
GNPTVPGESCVPCDCSGNVDPLEAGHCDSVTGECLKCIGNTAGAHCERCADGFYGDAVTA
KNCCACECHGKGSLSGVCHLETGVCDCKPHVTGQQCDRCSHGYYGLDTGLGCLPCNCSTP
GSLSDDCTEEGRCHCVPGVAGEKCDRCARGFYAFQDGGCTPCDCAHTQHTCHPESGQCIC
PPHTRGASCDECEDGYWGRDPELGCQACNCSAVGSATHQCDVLTGRCRCKPAFGGPSCHQ
CSLGYRDFPDCVPCDCDPRGTSADTCDEEQSLCSCAEETGICSCKENVFGLQCSECRAGT
YALRADDPLGCAPCFCFGLSQVCSELEGYVRTPITLGSGQPLLRVVSQSNLRGTTQGVYY
QAPDILLDAVTVRQHIHTEPFYWRLPERFQGDQLLAYGGRLKYSVAFYSSNGMGTFNLEP
QVLIKGGRTRKQVIYVDVPAPENGVRQDQEVGMKENFWRYFNSVSEKPVTRSDFMSVLSN
IEYILIKASYGQGLQQSRISNISMEVGKKADKLRPGQKVASRLEKCLCPPGTAGSSCQDC
APGYHRGELPQGGGRGPRPLLAPCVPCNCNNHSDACDPETGKCLNCSHSTTGDHCDLCAP
GYFGKVTGSASDCSVCACPRSHPASFSPTCVLEGDHDFRCDACILGYEGQYCERCSSGYH
GNPRALGGTCQRCDCSPSGSVHGDCDRRSGQCVCRPGATGLRCEECEPRHILLESDCVSC
DDECVGVLLNDLDNIGDAILSVNLTGVIPVPSGILSNLENTTKYLREALLKENTRKDLVE
DQLEDVAKQTDHLLRELTRVLTSSQHVTRATEGILDKSQDLMTFTEKLQRTIQEIIEKAA
TLNQTLDEDFQLPSSTLQNMQKNITSLLEVIQKRHFVQLQQKAILELKAAEDLLSQIQNN
YQKPQKELEVLKEAASSLLSKRSSELQAARDLVREAEVKNQESDRLLHIVSANLREFNDK
TVRVQQEQNLTSTLIARGRRLLDAVTAPADAVGDALAQLERHRDELLLWTAKIRRHVDDL
VMQMSQRRALDLVYRAEDHATELQRLAGALDSGLGSVRHVSLNATSATHVHSNIRSMIEE
SEKVAKDALKIVTTASLFSESLAPNGKVALQRSSRFLKEGNSLSRKHQGITLELSKLKNT
ANRFQENAHTITRRTNESLSILRAFPEGVRDKGAKIKELASSANRSAASTLKKVVGLSKE
LLNTSTGLSRVNAALQETNKLLQDSSMTTLLAGRRVKDAETQASLLFDRLKPLKILEENL
SRNLSEIKLLISQARKQAASIKVAVSADRDCVRAYQPQISSTNYNTLTLNVKTSEPDNLL
FYLGSSTSSDFLAVEMRRGKVAFLWDMGSGSTRLEFPDFRADDNKWHSIYVTRFGNIGSL
SVKEMSATQKPSTKTSKSPGTAKVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEA
FLNGQSIGLWNYIEREGKCHGCFGSPQNEDSSFHFDGSGYSVVEKTLRATVTQIIMLFST
FSPNGLLLYLASNGTKDFVSIELVRGRVRVTVDLGSGPLALITDRRYNNGTWYKIAFQRN
RKQGLLAVIDAYNTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRIVRKGVTSKSYV
GCIKNLEISRSTFDLLRNSYGVRKGCILEPIRTVSFLKGGYVELSPRSLLPESELLATFA
TKNSSGIILAALGRHGEKQGHRQAHGQPSQPFFSIMLIEGHIEVHVNSGDGANLRRAVLR
APKGTYGDGQEHSISLMRTGSIITVQMDETNPVEMKLGPSAESRTINVSSLYIGGVPEGE
GTSVLKMGRSFHGCIKNLIFNMEHLDFTSAVGYEQVDLDTCLLSERPKLALHGEDSELPP
EPQPLPSLGQCAVDRAPEYIPNAHQFGLMQSSHFVLPFNQLAVRKRLSVQLSIRTFASSG
LIYYMAHQNQVDYATLQLHGGHLHFMFDLGKGRTKVSHPAVISDGRWHTVKTEHFKRKGF
MTVDGQESPTVTAVGDGTMLDVEGKLYLGGLPSEYRARNIGNITHSVPACIGEVILNGKQ
LDKSSPVSAFAVSRCYAVAQEGTFFEGSGYAALVKEGYKVRSDVNITLEFRTTSENGVLL
GISSAKVDAIGLEIVNGKILFHVNNGAGRITATYKPKATSTLCDGRWHTLQAQKSKHRLV
LIVDGNAAHAESPHTQSTSADTNNPIYVGGYPADVKQNCLSSQTSFRGCLRKLTLIKGPQ
VQSYDFSRAFDLQGVFPHSCPGSQP
NT seq 9258 nt   +upstreamnt  +downstreamnt
atgcgcggcagtggcgcgggggtcgcgctcctggcctcgctgctctgggtcgccgcgcgg
tgccagcagagagggctgtttcctgccattctcaatcttgccagcaacgcgcacatcagc
accaacgccacctgtggggagcggggacccgagatgtcctgcaagcttgtggagcacgtg
cccggtcgacccgtgcgcaacgcacagtgccggatctgcgacgcggacagcgccaacccc
aaagaacgccacccaatatcccatgcaatcgatgggaccaacaactggtggcaaagcccc
agtattcaaaacgggagagaatatcactgggtcacaatcactctggacttaagacaggtc
tttcaagttgcctacgtcatcatcaaagctgctaatgcccctcgacccggaaactggatt
ttggagcgttctctggatggcaccaagttcagcccctggcagtactatgcagtcagtgac
acggagtgtttgacccgttacaatatcactccaagacgggggccgcccacttacagggct
gatgatgaagtgatctgcacctcctactattccagactggtgccgcttgagcacggagag
attcatacatcgctaatcaacggcagaccaagcgctgatgatctctcacccaagctgttg
gagtttacttctgcacgatatatccgccttcgcttacagcgtatcagaaccctcaatgcc
gatcttatgaccctcagccaccgagaccctaaagacctcgatcctattgttacaagacga
tattactattcaatcaaagacatttctgttggcggaatgtgtatttgttatggccatgcc
agtagctgcccatgggatgaaactacaaagaagcttcagtgtcagtgtgaacataacacc
tgtggagagagctgcaataggtgttgtccgggataccaccagcagccgtggcggcccggc
accatttcttccggtaacacgtgtgaaaaatgtaattgtcacaataaagcccaagactgt
tactatgatggaaatgttgcaaatcagaggagaagcttgaataccgcgggacagttcaga
ggaggcggggtgtgcatcagctgcctgcagaacaccatgggaatcaactgtgaaacctgt
atcgatggatattacagaccacacgatgtatctccttatgatgacaacccttgtcgtccc
tgtgactgtgacccttttgggtccctcagttctgtctgtattaaggataagcctcaatct
ggcttacacaaagggaagtggccaggtcaatgtccatgcaaggaaggctacgcaggagaa
aaatgtgatcactgccaatttggttataagggttacccagcctgtgtccgctgtgagtgt
agccgggctggcggtgtgaacgaggacccatgctcagagccctgtctctgcaaggaaaat
gttgaaggggaaaattgtgacctctgcaagccaggattctataacttgaaggagagaaac
cccgagggctgctcggagtgcttctgctttggcgtttctgatgtctgcgacagcctttct
tggtccatcagtcaggtgaaagacatgtctgggtggcttgtcaccgacctgatcagtccg
agcaagatcccatctcagcaagacgcactgggtgggcgtcatcagattagcatcaacaac
acggtggccacgcagaggctgacttccaagtattactggtcggcaccggaggcctacctc
ggaaataagctgactgctttcggtggattcctgaagtacacagtgtcctatgatattcca
gtggagacagtggatggcgacctcatgtcgcacaccgatgtcatcatcaagggaaatgga
ctcactttaagcacccaggccgagggcctgtcattacagccctatgaagagtatttaaac
gtggtcagacttgtgccagagaacttccgagattttaataacaaaaaggagatagatcgt
gaccaactgatgactgtccttgccaatgtgacacatctcctgatcagagccaactataat
tctgcaaaaatggctctttacaggttggattctgtctctttggacacagccagccctaac
gttatagacctggcactggccacggaggtggagcactgcgaatgtccccaaggctatgca
gggatctcttgtgagtcctgtctccctggctattatcgtgtggatggaatactctttgga
ggaatttgtcaaccctgtgaatgccatggccatgcaactgaatgcgatatccacggcgtt
tgctttgcgtgcaagcacaacaccaccggggaccactgtgagcagtgcgcgcccggcttc
tacgggctgccttcccgagggactcctagggactgccagcagtgtgcctgccccctctcc
acagcctccaacaatttcagtcccacctgccacctagaagatggggacgaagtggtctgt
gaccagtgtgcccctggatactcgggagcttggtgcgagagatgcgcagacggttactat
ggaaacccaacagtgcccggggaatcctgtgttccctgcgactgcagcggcaatgtggat
cccttagaggccggtcactgtgactccgtcaccggagagtgcctgaaatgcattgggaac
acggctggtgcccactgtgagaggtgtgcggacggcttctatggggatgccgtgactgct
aaaaattgctgcgcctgtgaatgccatggaaaaggctccctttctggtgtctgccatctg
gagactggagtctgtgactgcaaaccgcatgtgactggacagcagtgtgaccggtgctcg
catggctattatgggctggacacagggcttgggtgcttgccctgtaactgcagcacgcca
ggctccctgtcggatgactgcacggaggaaggccgatgtcactgtgtgccaggtgtggct
ggggaaaagtgcgacaggtgtgcgcgtggcttctatgcgttccaggacggcggctgtaca
ccctgtgactgcgcccacacgcagcacacttgtcacccggaatcggggcagtgcatctgc
cctcctcatactcggggcgcatcctgtgacgaatgtgaggacggatactggggccgcgac
ccagagctcggatgccaggcctgcaattgcagtgctgttgggtcagccactcatcagtgc
gatgtgctcactggccgttgccgatgtaagccagcgttcggtggaccgagctgccaccag
tgctccctggggtacagagactttccagactgcgtgccctgtgactgtgacccaagaggg
acctcggcagacacctgtgatgaggaacagagtctttgcagctgtgcagaagaaaccggt
atctgctcttgcaaggaaaatgtgtttggcctgcagtgcagcgagtgtcgagccggcacc
tatgctctccgcgccgacgaccctctggggtgcgccccctgcttctgcttcgggctgtca
caagtctgctcagagctcgagggttatgtgaggaccccgataacgctgggctcgggtcag
ccgctcctgcgtgtggtttctcagagcaacctcaggggcacgacccagggggtgtattac
caggctcctgatatcctcctggacgccgtgactgtcaggcagcatattcacacggagccg
ttctactggagactgccagagaggttccagggagaccagctcctggcctacggtggcaga
ctgaagtacagcgtggccttctattcttccaatggcatgggcaccttcaaccttgaaccc
caagtgctcatcaaaggaggccggaccagaaagcaagtcatctacgtggatgtgccagcc
ccggagaatggcgtgcgacaagaccaagaagtgggaatgaaagagaatttttggagatat
tttaactctgtttctgaaaaacctgtcacacgctccgattttatgtctgttcttagcaac
attgagtacatcctcatcaaagcatcttatggtcagggattacagcaaagcagaatctca
aatatttccatggaggttggcaaaaaggcggacaagttgcggccgggacagaaggtggca
tcccgtttagagaagtgtctctgtcctcctggcacggctgggtcctcctgtcaggactgc
gcacctggttaccacagaggggagctgccgcaaggtggtggccgaggaccccgccctctg
ctcgctccttgtgtgccctgcaattgcaacaaccacagcgatgcctgtgaccccgaaact
gggaagtgcctgaactgcagccatagcaccactggtgaccactgtgacttgtgtgctcct
gggtacttcgggaaggtgactggctcagccagcgactgctctgtgtgcgcctgtcctcgc
agccaccctgccagttttagtcccacttgtgtcttggaaggtgatcacgatttccgctgt
gatgcctgcattctgggctacgaaggacagtactgcgaaaggtgctcctcaggctatcac
gggaaccctcgagcgctgggtggcacttgccagcggtgtgactgcagccccagtggctct
gtccacggtgactgtgaccgcaggtccgggcagtgtgtctgcaggccaggcgccacaggg
ctccgatgcgaggaatgtgaaccgaggcacattctgctggaaagcgattgtgtttcttgt
gatgatgaatgtgtgggtgtgctgctaaatgacttagataatattggggacgccatcctt
tccgtgaacctcactggcgttatccctgtcccatctggaattttgtcaaacctggaaaat
acaacgaaatatctccgggaagctttattaaaagaaaatacacgtaaggacctggtagaa
gatcagcttgaagatgttgcaaaacaaacagaccacctgctaagggagctcactagagtg
ttaacgagtagccaacatgtaaccagggcgactgaaggaatccttgacaagagccaagac
ctcatgacatttactgagaagctgcagagaactatccaagagattattgaaaaagcagca
actctaaatcagaccttggatgaagacttccaactacccagttctactcttcagaatatg
caaaagaatattacatctttgctagaagtcatacagaaaaggcatttcgtgcagttgcaa
cagaaagccatactggaactcaaggctgctgaagatttattgtcacagattcagaacaat
taccagaagccacagaaagagttggaggtattaaaagaagcagcaagcagccttctttca
aaacgcagcagtgaactgcaggcagcgagggaccttgtgagggaagcagaggtgaagaac
caggagagcgaccgcctgctgcacattgtcagcgccaacctgcgagaatttaacgataag
acggtgcgtgttcagcaagagcaaaacttgacctccacgctgattgccagagggagaaga
ttgctagacgctgtcactgcacctgcagatgctgtaggagatgctctagcacagttagag
cgtcaccgagatgagctacttttatggactgccaaaatcaggcgccatgtagatgatctg
gtcatgcagatgtcccaaaggagagctcttgaccttgtctacagagcagaggaccacgcg
actgaactccagagactagcaggtgctctggacagtggccttggcagcgttagacacgtg
tccctgaatgccaccagtgcaacccacgtccattccaacattcggagcatgattgaagaa
tcagagaaagtggcaaaagatgctctcaagatcgtgacaacggcgagtctgttctcagaa
tcccttgctcccaatgggaaagtggctctccagcgcagttccagatttctaaaagaaggc
aacagcctgagcagaaagcatcaaggtatcacattggaactgagtaaattgaaaaataca
gcaaacagatttcaagagaatgctcatacaattactaggcggaccaatgaatcactctcc
atccttagagcattccctgaaggtgtcagagacaaaggagccaaaatcaaagagctggcc
tcatctgcaaatcggagtgctgcaagcaccctaaagaaggttgtgggattgagcaaggag
ctgttgaatacatcaactggcttgtccagggttaatgccgccttacaagaaacaaacaaa
cttctgcaggactcttcaatgaccactctgctcgctggaagaagagttaaagatgcagaa
acacaagccagccttttatttgatcggttgaagcctctgaagatactagaagagaacctg
agcagaaacctatcagaaatcaaactgctgatcagccaggcccggaaacaagcagcttct
attaaagtcgctgtgtctgcagacagagattgtgtccgggcctaccagcctcagatttct
tctactaactataacaccttaacactaaatgttaagacaagtgaacccgataaccttctc
ttctacctcgggagcagcaccagttctgatttcctggcagtggagatgcggcgagggaag
gtggcctttctctgggatatgggctccgggtctacacggttggaatttccagacttccga
gctgacgacaacaaatggcacagtatctatgtaaccagatttggaaacattggttcattg
agtgtaaaggaaatgagtgcaactcaaaagccatcaacaaaaacaagtaaatcccctgga
acagctaaagttctggatgtaaacaattcaacactaatgtttgttggagggcttggagga
cagatcaagaagtctcctgctgtgaaggttactcattttaaaggctgcatgggagaggcc
ttcttgaacggacagtccatcggcctgtggaactatattgaacgggagggcaagtgccac
ggctgcttcggaagcccccagaacgaagactcgtccttccattttgatgggagtggttat
tcggttgtggagaagacgctccgggctaccgtgactcagataattatgctttttagtacc
ttttcacccaacgggcttcttctctaccttgcttcaaacggcactaaagactttgtatcc
atcgagctggtgcgtggcagagttagagttacagttgacctgggttcagggcctcttgct
cttattacagacagacgctataacaacggaacctggtataaaatcgccttccagagaaac
cgaaagcaaggactcctagcagttattgatgcatataacaccagttataaagaaacgaag
caaggtgaaactccaggagcatcttctgacctcaatcgtctagataaagatccaatttat
gtgggtggattacctaggtcaagaattgtaaggaaaggtgtcaccagcaaaagctatgtg
ggctgtatcaaaaacctggagatatccagatcaacctttgatttactcagaaattcctat
ggagtgagaaaaggctgtatactggagcctatccgaactgttagcttcttgaaaggtggc
tacgttgaattgtcacccaggtctttgttgccagaatcggaactgttggcaacatttgcc
accaagaacagcagtggcatcatcctggctgccctgggcaggcatggggagaagcagggt
catcggcaggcccacgggcaaccttcccagcccttcttttccatcatgctgattgaaggc
cacattgaagtgcacgttaactctggggacggagcaaacctgagaagagctgtcctgcgt
gctcccaagggcacatacggtgacgggcaagagcattccatctctctgatgaggactggg
agcattatcactgtccaaatggatgagacaaatcctgtagaaatgaagttgggcccatca
gcagaaagcaggacaataaatgtatccagcctgtacatagggggagttccagagggtgag
gggacatcagtgctcaagatgggaagatcatttcacggctgtatcaaaaacctgatcttt
aacatggaacatttggatttcacgagtgcggttggttatgaacaagtagatttggacacc
tgcttgctttcagaaaggccgaagctggctcttcatggagaggacagcgagctcccgcca
gagcctcagcctttaccaagtctagggcagtgtgctgtggacagagccccagagtacatc
cccaacgctcaccagtttggcctcatgcaaagcagccattttgtgttgcccttcaatcag
ctggctgtcagaaagaggctctcagttcagctaagtatccggacatttgcctccagcggt
ctgatttactacatggctcatcagaaccaagttgattatgccacgctccagctgcatggg
ggccaccttcacttcatgtttgatcttgggaaaggcagaacaaaggtctcccaccctgca
gtgatcagtgatggcaggtggcacacggtcaagacagagcactttaaaagaaagggcttc
atgacagttgatggccaggaatcccccacggtgacagctgtgggagatggtaccatgttg
gatgtggaaggaaagctgtacctaggaggtcttccctctgagtacagagccaggaacatt
ggaaacatcacccacagtgtccccgcctgcattggggaggtgatactgaatggcaaacag
ctggacaaaagcagcccagtgtctgcatttgcagtaagcaggtgctatgcagtggctcag
gaaggaacgttctttgagggcagtggatacgcagctcttgtcaaggaaggctacaaagtc
cgatcagatgtaaatataacactggaatttcgtaccacctctgagaatggtgtcctcctg
gggatcagcagcgccaaagtagatgccatcggattagagattgtgaatggcaagatcttg
tttcatgttaacaatggtgctggtcggataacagccacatataaacccaaagctaccagt
actctgtgcgatggaagatggcacacacttcaagctcagaaaagcaaacaccgcttggtt
ctgattgtcgatgggaatgcagctcacgctgaaagtccacacacccagtccacctcagca
gacaccaacaatcccatttatgtgggcggctaccctgctgacgtaaagcaaaactgcctg
agcagccagacctccttccgggggtgcttgagaaagctcactctgattaagggcccacaa
gtgcaatcctatgacttcagcagagcttttgatctacaaggagttttccctcattcctgt
cctgggtctcaaccctga

KEGG   Felis catus (domestic cat): 101083923
Entry
101083923         CDS       T02385                                 
Symbol
LAMA5
Name
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101083923 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101083923 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101083923 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101083923 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101083923 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101083923 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101083923 (LAMA5)
   05145 Toxoplasmosis
    101083923 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 101083923
NCBI-ProteinID: XP_023106802
Ensembl: ENSFCAG00000018350
LinkDB
Position
A3:1830350..1882491
AA seq 3699 aa
MARPDARLCAGCARGPRAPVPLLLAGLALLGAARAREAAGGGFSLHPPYFNLAEGARITA
SATCGEETPARGAPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAAHSNRAHPVSNA
IDGTERWWQSPPLSRGLHYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSTDFGH
TYQPWQFFASSKRDCFERFGPQTLERITRDDHVICSTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADVCDAQDPTDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTESANECQSCN
CHGHAHDCFYDPEVDRRNASQNLDGAYQGGGVCIDCQHHTTGINCERCLPGFFRAPDQPL
DSPHACRRCNCESDFTDGTCEDLTGRCYCRPNFTGERCDACAEGFAGFPRCYPASSSPNH
TGEQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPAFQGVHCELCAPGFYGPSCQP
CRCSSPGVVDGDCDPDSGHCVCREGFEGAACDRCAPGYFHFPLCQLCGCSPVGTLPEGCD
EAGRCPCRPGFDGPHCDRCSPGHHGYPDCHACTCDPRGALDQLCGAGGVCLCRPGYTGAT
CQECSPGFHGFPHCAPCRCSAEGSLHAACDPRSGQCSCRPHVTGLRCDACVPGAYNFPTC
EAGSCHPAGLAPADHTRPEAQAPCTCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDP
RGTLGGVAECRPGDGQCSCKPHVCGQACAACRDGFFGLDRADYFGCRSCRCDVGGALGQG
CDPRTGACRCRPNTQGLTCAEPARDHYLPDLHDLRLELEEAATPEGRTARFGFNPLEFES
FGWRGYAQMSPIQPRIVVRLNVTSPDLFRLVFRFVNRGPSSVSGRVSVQEEGKFATCTNC
TEQSQPVTFPPSTEPAFVTVPQRGFGEPFVLNPGAWALLVEAEGVLLDYVVLLPSTYYEA
AVLQLRVTEACTFRPAEQRFRENCLLYTHLPLDGFPSAAGTEALCRRDNSLPWPCPTEQL
SPSHPPLAACLGSDVDVQLQVAVPQPGRYVLVVEYANEDARQEVGVGVHVPRRAPQQAAL
TLHPCLYSTLCRGAALDTQHHLAVFHLDTEASVRLTAKQARFFLHSVTLVPAETFSLEFV
EPRVRCVSSHGAFEPSSATCLPSRFPKPPQPIILRDCHVLLLPPGLPLARSQDFTPGALP
PGPQPRPSTAVDPDVEPTLLRHPQGTVVFTTHVPVLGRYAFLLHGYQPAHPTFTVEVLVS
GGRVWQGHANASFCPHGYGCRTLVVCEGQTVLDVTDSELTVTVRVPEGRWLWLEYVLVVP
EEAYSSRYLREEPLDKSYDFISQCASQGYHISPSSSSQFCRDAASSLSLFYNNGARPCGC
HEMGAMGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPSCRPCDCRGRLCDELTGRCVC
PPRTVPPDCIVCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCKCRPNVAGRR
CDTCAPGFHGYPSCRPCDCHEAGSTPGVCDPLTGQCYCKENVQGLRCDQCRLGTFFLDAA
NPKGCTRCFCFGATERCGSSAHTRRELVDMEGWTLLSSDRQVVPHELRAASELLYADLRL
GAEAFPELYWQAPPSYLGDKVSSYGGTLRYELHSETQRGDVFIPMESRPDVVLQGNQMSI
MFLEPAYPAPGHVHRGQLQLVEGNFRHTETHSAVSREELMMVLAGLEELHIRALFSQTSS
AVSLRRVALEVAGEAGGGPPASNVESCMCPANYLGDSCQECAPGYYRDVKGLFLGRCVPC
QCHGHSDRCLPGSGVCEGCQHNTEGDRCEHCQAGFVRSGSEDPTAPCVSCPCPLAVPSNN
FAVGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPMVLGSSCQPCDCSGNGDPNLLFSD
CDPLTGACRGCLRHTAGPRCESCAPGFYGNALLPGNCTRCDCSPCGTETCDPHSGHCVCK
PGVTGPRCDRCQEGHFGFQSCGGCRPCACGPAAEGSECHPQSGQCHCRPGAGGPQCRECA
PGHWGRPEQGCRRCRCQGGHCDLHTGRCTCPPGLSGERCDTCSHQHQVPVPDGPGDRGVH
CEVCDHCVVLLLDDLEQAGALLPAIRQQLHGISTSSVAWARLHRLNASITDLKSQLRSPP
GPRHETAQQLEALERQSSGLGQDMQRLDGQATRALARASRLLDGTEASLGRAQTLLASIR
AVDRILTELESQTGHLFPANVSAPSGELVRRTLAEVERLLGEMRARDLGAPRAAAEAELD
KARRLLARVQEQLTSRWEGNQALAERTRDQLARHEAGLMDLRGALNRAVGTTREAEELNS
QNQERLEEVLQRKQELSRDNATLSATLQAARNILAQLSERLHGMDQAREEYERLAANLDG
ARTPLLEKMRAFSPASSKVDLVEAAEAHARQLDQLALNLTSIIQGVNRDRFIQRAIEAAN
AYGSILQAVQAAEGAAGQALQEASRTWATVVQRGLEPRARQLLANSSALVEAVLREEQRL
GRARATLRGTGTPLRDAQAKREQLAARVREVQAMLAMDTDETSRKIAHAKAVAAGAQDTA
ARVQSRIRNMQQNLERWQGQYGGLRSQDLGQVVLDAGRSVSTLEKTLPRLLAKLSLLENR
GAHNASLALSTNIGRVRELIAQARGAASKVKVPMKFNGRSGVQLRAPRDLSDLAAYTALK
FYLQSPKLASGQVTGDRFVLYMGSRQAVGDYMGVALRDQKVHWVYRLGEAGPATLSVDEN
IGEQFAAVSIDRTLQFGHMSITVEKQTVHETKADTVAPGTQGLLSLHPDNFVFYVGGYPS
DFTPPEPLRFPGYLGCIEMNTLNEEVFSLYNFEETFQLDTAVDKPCARSKATGDPWLTDG
SYLDGSGFARISVGSQIGHTKRFEQELRLVSSNGIIFFLQHQDQFLCLAVRKGNLTLLYD
FGTGLQEAQTPHNLAHKLQALTSASKAIQVFLLAENRKRVLVRVERSSVFSVDQDNTLEL
ADAYYLGGVPPDQLPPSLRQLFPSGGSIRGCIKGIKALGKYVDLKRLNTTGVSAGCTADL
LMQRAVTFHGDGFLSLELPHVAPLTGHVYSGFGFRSTQDSGLLYHRGSEDELCQVSLKQG
RVTLRLLRMEVKTRDGFADGAPHYVAFYSNDTGVWLYVDDQLQQMKPHQGPSLRPQPQPQ
PPQAAELSLGGRPEPGDFFSGCISNVFVRRLLGPQRVFDLQQYSKSVNVTADCAPAPRAQ
TLGRAPQGPRAAALRKASRRSRQPPRDAACTPPRPLRSPRDAYQFGGPLPCHLEFAHVPA
PPGDWSQVSMLVRPRAPRGLLLLAAPLTAGGPSLLLLLSHGRFVAQTEGPGPRLRVQSRR
RSRAGRWHMVSVRWEKTRIQLVIDGVRAQDRERPGQQRREPGSPRPRTLFVGGLPASGFS
PRPPVAVSGFSGCVRRLRLDGRPLGPPTRVVGVTPCFSGPLEKGLFFAESGGVVTADTLG
ITLLDVSLELEVRPRAASGLLFHLGRGRAPPYLQLQLREKEVLLRADDGGGEFSTWVTCP
AALCDGQWHRLAVTKGGNTLRLTVDTQTNGTRGPTVAVASGDALAPLHFGGLPGPTNTQA
GPLAYHGCMRNLVVNRSPVTWPRSVGVQGAVGASGCPAT
NT seq 11100 nt   +upstreamnt  +downstreamnt
atggcgaggccggacgcgcggctctgcgcggggtgcgcacgggggccccgggcccccgtg
ccgctgctcctggccgggctggcgctgctgggcgcagcgcgggcgcgggaggcggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcaccgcg
tcggccacctgcggcgaggagaccccagcgcgcggcgccccgcgccccaccgaggacctc
tactgcaagctggtgggcggccccgtggccggcggagaccccaaccagaccatccagggc
cagtactgcgacatctgcaccgccgcacacagcaacagggcacaccccgtgagcaacgcc
atcgacggcacggagcgctggtggcagagtccgccgctgtcccggggactgcactacaat
gaggtcaacgtcaccctggacctgggccaggttttccacgtggcctatgtgctcatcaag
ttcgccaactcgccgagaccggacctctgggtgctggagcggtccacggacttcggccac
acctaccagccgtggcagttctttgcctcctccaagagggactgttttgagcggttcggg
ccacagacgctggagcgcattacgcgggacgaccacgtcatttgctccactgagtactct
cggatcgtgcccctggagaacggcgagattgtggtatccctggtgaacgggcgcccgggg
gccatgaacttctcctactcacccctgctgcgtgacttcaccaaagctaccaacatccgt
ctgcgcttcctgcgcacaaacacgctgctgggccacctcatgggcaaggcgctgcgggac
cccaccgtcacccgccggtattattatagcatcaaggacatcagcatcggtggccgctgc
gtctgccatggccacgcggacgtctgtgacgcccaagaccccacggaccccttcaggctt
cagtgtgcctgtcagcacaacacatgtgggggctcctgtgaccgctgctgcccaggcttc
aaccagcagccgtggaagccggcaaccaccgaaagcgccaacgagtgccagtcctgcaac
tgccacggccacgcccacgactgcttctacgacccggaggtggaccggcgcaacgccagc
cagaacctggacggcgcgtaccagggcgggggcgtgtgcatcgactgccagcatcacacg
accggcatcaactgtgaacgctgcctgcccggcttcttccgtgccccggaccagcccctt
gactctccccacgcttgccgccgctgcaactgcgagtcggacttcacggacgggacgtgc
gaagatctgaccggccgctgctactgccggcccaacttcaccggggagcgctgcgacgcg
tgcgccgagggcttcgccggcttccctcgctgctacccagcgtcctcctcccccaaccac
accggggaacaggtgctgccagccggacagatcgtgaactgtgactgcagcgccgccggg
acccagggcaacgcctgccggaaggacccgcgggtgggacgctgcgtgtgcaaacccgcc
ttccagggcgtccactgcgagctctgtgccccggggttctacggcccgagctgccagccc
tgccggtgttccagccccggagtggtggatggggactgcgaccctgactcaggccactgc
gtgtgccgggagggcttcgagggggccgcgtgtgaccgctgtgccccgggatacttccac
tttcctctctgccagctgtgtggctgcagccccgtggggaccctgcccgagggctgcgat
gaggccggccgctgcccgtgccggccagggttcgacggccctcactgtgaccgctgcagc
ccgggccaccatggctaccccgactgccatgcctgcacctgcgacccccggggtgccctg
gaccagctctgcggggcagggggcgtgtgcctctgtcgccccggctacacgggcgctacc
tgccaggaatgcagccccggcttccacggcttcccccactgtgccccctgccgctgctcc
gccgagggctccctgcacgcggcctgtgacccccgcagcgggcagtgcagctgccggccc
cacgtgacggggctgcggtgtgacgcctgtgtgcccggcgcctacaacttccccacctgt
gaagccgggtcctgccaccctgccggcctggccccggccgatcacacccgtcctgaggca
caggccccttgcacgtgccgggctcatgtggaggggccgagctgcgatcgctgtaaaccc
gggttctgggggctgagtcccagcaaccccgagggctgcacccgctgcagctgtgatccc
cggggcacgctgggtggagtcgccgaatgccggccgggcgacggccagtgctcctgcaag
cctcacgtgtgtggccaggcctgcgcagcgtgccgggacggcttcttcgggctggaccga
gctgactactttggctgccgcagctgccggtgtgacgttggcggtgcgctgggacagggc
tgtgacccgcggacgggcgcctgccggtgccgccccaacacccagggcctcacctgtgcc
gagccggcgcgggaccactacctccctgacctacacgacctacgcctggagctggaggag
gcggccacgcccgagggccgcaccgcgcgctttggcttcaaccccctcgagttcgagagc
ttcggctggaggggctatgcgcaaatgtcgcccatccagcccaggatcgtggtgaggctg
aacgtgacctcccctgacctcttccggctcgtcttccggttcgtcaaccgcgggcccagc
agtgtgagtgggcgagtctctgtacaggaggagggcaagtttgccacctgcaccaactgt
acggagcagagccagcctgtcaccttcccacccagcacggagcctgcctttgtcaccgtg
ccccagaggggctttggggagccctttgtgctgaaccccggcgcctgggccctgctcgtg
gaggctgagggggtgctcctggactatgtggtccttctacccagcacctactacgaggcg
gctgtcctgcagctgcgggtgaccgaggcctgcacgttccggcctgctgagcagcgcttc
agggagaactgcctcctctacacgcacctgcccctggatggcttcccctcagctgcagga
accgaggccctgtgtcgccgtgacaacagcttgccctggccgtgccccacggagcagctc
agcccttcgcacccgcccctggccgcctgcctgggcagtgacgtggacgttcagcttcag
gtggctgtgccacagccgggccgctacgtcctggtggtggagtatgccaatgaggacgcc
cgccaggaggtgggcgtaggcgtgcacgtcccgcggcgggcccctcagcaggcggcactc
actttgcacccctgcctctacagcaccctgtgccggggcgccgccctggacacgcagcac
cacctggcggtcttccacctggacacggaggccagcgtccggctcacggccaagcaggca
cgcttcttcctgcacagcgtcaccctggtgcccgcggagacgttcagcttggagttcgtg
gagccccgggtccgctgtgtcagcagccacggtgccttcgagcccagcagtgccacctgc
ctgccgtcgcgcttcccgaagccgccccagcccatcatcctgcgggactgccacgtgctg
ctgctgcctcccggcctccccctggcccgctcgcaggacttcacgcccggcgcgctcccg
ccagggccccagcctcggccctccactgccgtggaccccgacgtggagcccaccctgctg
cgccacccccaggggactgtggtcttcaccacccacgtgcctgtgctgggccgctacgcc
ttcctgctgcatggctaccagccggcgcaccccaccttcaccgtggaggtcctcgtcagc
gggggccgagtctggcagggccacgccaacgccagcttctgcccgcacggctatggctgc
cgcaccctggtggtgtgtgagggccagactgtcctggatgtgaccgacagcgagctcacc
gtgaccgtgcgtgtgcccgagggccggtggctctggctggagtatgtgctggtggtcccc
gaggaggcctacagctccaggtacctccgagaggagcccctggacaaatcctacgacttc
atcagccagtgtgccagccagggataccacatcagccccagcagctcgtcccagttctgt
cgtgatgcagcctcctctctctctctcttctataacaacggggctcggccttgcggctgc
catgaaatgggagccatgggccccacatgtgagccctttgggggccagtgtccctgccgt
gcccatgtcatcggccgtgactgctcccgttgtgccactggctactggggcttccccagc
tgcaggccctgtgactgccgaggccgcctgtgtgatgagctcaccggccgctgtgtctgc
ccgcctcgcaccgtcccgcccgactgcatcgtctgtcagccccagacctttggctgccac
cccctggttggctgtgaggagtgtaactgctcggggcctggtgtccaggagctcacggat
cccacctgtgacatggacagtggccagtgcaagtgcagacccaatgtggccgggcgccgc
tgtgacacctgtgcccctggcttccacggctaccccagctgtcgcccctgtgactgccac
gaagcgggctccacgcccggcgtgtgcgaccccctcacgggccagtgctactgcaaggag
aacgtgcagggcctgaggtgtgaccagtgccgcctggggaccttcttcctggacgctgcc
aaccccaaaggctgcacccgctgcttctgcttcggggccaccgagcgctgcgggagctcg
gcccacacccgccgggagcttgtggacatggagggctggacgctgctgagcagcgaccgg
caggtggtgcctcacgagctgcgggcggcctcggagctgctctacgccgacttgcggctc
ggggccgaggccttccctgagctgtactggcaggccccaccctcctacctgggggacaag
gtgtcatcctatggcgggaccctccgctacgaacttcactcggagacccagcggggagac
gtgttcatccccatggaaagcaggccggacgtagtgctgcagggcaaccagatgagcatc
atgttcctggagccggcgtacccggcgcccggccacgtccaccgcgggcagctgcagctg
gtggaggggaacttccggcacacggagacccacagcgccgtgtcccgcgaggagctcatg
atggtactggcgggcctggaggagctgcacattcgcgctctcttctcccagacctcctcg
gccgtctccctgcgcagggtggcgctggaggtggccggcgaggcgggcggggggcctcca
gccagcaacgtggagtcgtgcatgtgccctgccaactaccttggggattcctgccaggag
tgtgcccccggctattaccgggacgtcaaaggtctcttcttgggtcgctgtgtcccctgt
cagtgccacggccactcagaccgctgcctccccggctcgggcgtctgcgagggctgccag
cacaacaccgagggcgaccgctgcgagcactgccaggctggctttgttcgcagtgggtcc
gaggacccgacggccccctgtgtcagctgcccctgccccctcgccgtgccttccaacaac
ttcgcggtgggctgcgtcctgcgaggtggccgcacacagtgtctctgcaaacccggctat
gcgggcgcctcctgcgagcggtgcgcgccgggcttcttcgggaaccctatggtgctgggc
agctcgtgccagccgtgcgactgcagtggcaacggtgaccccaacctgctcttcagcgac
tgcgaccccctgacgggcgcctgccgcggctgcctgcgccacaccgccgggccccgctgc
gagagctgcgcccccggcttctacggcaacgccctgctgcccggcaactgcacccggtgt
gactgctccccgtgcgggacggagacctgtgacccccacagcgggcactgcgtgtgcaag
ccaggcgtgacaggcccgcgctgtgaccgctgtcaggaaggacacttcggcttccagagc
tgtggcggctgccgcccgtgtgcctgcggaccagccgcggagggctctgagtgccacccc
cagagtgggcagtgccactgccggccaggggcgggagggccccagtgccgtgagtgcgcc
ccgggccactgggggcgccctgagcagggctgcaggcgctgccggtgccaagggggccac
tgtgacctgcacaccggccgctgcacgtgcccccccgggctcagcggggagcgctgtgac
acctgcagtcaccagcaccaggtgccggtgcccgacgggcctggggaccgtggtgtccac
tgcgaagtgtgtgaccactgtgtggtgctgctcctggacgacctagagcaggccggcgcc
ctcctccctgccatccggcagcagttgcacggaatcagcaccagctcggtggcctgggcc
cggctgcacaggctgaatgcctccatcactgacctgaagagccagctccggagtcctccg
ggcccccgccatgagacagcacagcagctggaggccctggaacgacagagctcaggcctc
ggacaggacatgcagaggctagacggccaggccacaagagccctagcccgggctagccgg
ctcctggacggcactgaggcctcgctgggccgggcgcagacactgctggcatccatcagg
gctgtggaccgcatcctgactgagcttgagtcccagacaggccacctgttcccggccaac
gtctcagccccctcgggtgagctcgtgcgccggacgctggccgaggtggagcgactgctt
ggggagatgcgggcccgagacctgggcgccccgagagcagcggctgaggctgagctggac
aaagcccggagactgctggcccgcgtgcaggaacaactgaccagccgctgggaggggaac
caggcactggccgagcgcacccgagaccagctggcccggcacgaggccggcctcatggac
cttcgaggggccctgaatcgggcggtgggcaccactcgggaggcggaggaactcaacagc
caaaatcaggagcgcctggaggaggtcctgcaacggaagcaggagctgtccagggacaat
gccactctgagtgccaccctgcaggcggcccggaacatcctggcccagctctcggagcgc
ctgcacggcatggaccaggccagggaggagtacgagcgcctggccgcaaacctggacggg
gcccggaccccactgctggagaagatgcgggccttctccccggcgagcagcaaggtggat
ctggtggaggctgccgaggcgcacgcgcggcagctggaccagctggccctcaacctgacc
agcatcatccaaggagtcaaccgggaccgtttcatccagcgggccatcgaggccgctaac
gcctacggcagcatcctccaagctgtgcaggccgcggagggcgctgctggccaggcgctg
caggaggcgagccgcacgtgggcgaccgtggtgcagcggggcctggagccccgagcccgg
cagctgttggccaacagcagcgccctggtggaggccgtcctccgggaggagcagaggttg
ggccgtgcgcgggctaccctccggggcaccgggaccccgctccgagatgcccaggccaag
agggagcagctggcagcccgagtccgggaggtacaggccatgttggccatggacacagac
gagacgagcaggaagatcgctcatgccaaagccgtggccgctggagcccaggacacggcc
gcccgtgtgcagtcccggattcggaacatgcagcagaacttggagcggtggcagggccag
tacgggggcctgcggagccaggacctgggccaggtggtcctggacgcgggccgctcagtg
tccaccctggagaagacgctgccacggctgctggccaagctgagcctcctggaaaaccgt
ggggcgcacaacgccagcctggccttgtccaccaacatcggccgcgtgcgggagctcatt
gcccaagcccggggggctgccagcaaggtcaaggtgcccatgaagttcaatgggcgctcg
ggggtgcagctgcgtgcccctcgggacctctccgacctcgccgcctacaccgctctcaag
ttctacctccagagtccaaagctggcgtctggccaggtcaccggggaccgcttcgtgctg
tacatgggcagccgccaggctgttggcgactacatgggcgtggctctgcgcgaccagaag
gtacactgggtgtaccgcctgggggaggcgggccccgccaccctgagcgtggacgagaac
ataggggagcagttcgccgcagtcagcatcgacaggaccctccagttcggccacatgtcc
atcacggtggagaagcagacggtccatgagaccaaggccgacacggtggcccctgggacc
caggggctgcttagcctgcatcctgacaacttcgtcttctacgtggggggctaccccagc
gacttcacgcccccggagcctctccgctttcccggctacctcggctgcatcgagatgaac
acgctcaacgaggaggttttcagtctctataacttcgaggagaccttccagctggacacg
gccgtggacaagccttgcgcccgctccaaggcgaccggggacccgtggctcactgatggc
tcctacctggacggctcgggcttcgcgcgcatcagcgtgggcagtcagataggccacacg
aagcgtttcgagcaggagctccggcttgtgtcctccaacgggatcatctttttcctgcag
caccaggaccagttcttgtgcctggcagtgcggaagggcaacctcaccctcctctatgac
tttggcaccggcctgcaggaggcacaaacaccccacaacctggcacacaagctgcaggcc
ctgacctccgccagcaaggcgatccaggtgttcctgctggcggaaaaccgcaagcgcgtg
ctggtgcgcgtggagaggagctccgtgttcagcgtggaccaggacaacacgctggagctg
gcggatgcctactacctggggggcgtgccgcctgaccagctgccccccagcctgcggcag
ctcttcccctccggaggctccatccgcggctgcatcaagggcatcaaggctctgggcaag
tacgtggacctcaagaggctgaacacgaccggcgtgagcgcgggctgcaccgccgacctg
ctgatgcaacgggccgtgactttccacggcgacggcttcctgtccctggagctccctcac
gttgctcccctcacgggccacgtctactcgggattcggcttccgcagcacgcaggacagc
ggtctgctctaccaccgaggatccgaggatgagctatgccaggtgtccctgaagcagggc
cgcgtgacgctccggctgttgaggatggaggtgaaaactcgcgatggctttgctgacggt
gccccccattatgtcgctttctacagcaacgacacaggggtctggctctatgtggatgac
caacttcagcagatgaagccccaccaggggccgtccctccggccccagccccagccccag
cctcctcaagccgctgagctgtccttgggaggcaggccggagcctggcgactttttcagt
ggctgcatcagcaatgtcttcgtgcggcggctcctggggccgcagcgtgtgttcgacctg
cagcagtactccaaaagcgtcaatgtgaccgcagactgcgctcctgcgccacgtgcccag
acccttgggcgggcacctcaaggaccgcgggctgcggcgctgcggaaggcttcccgacgc
agccgccagcccccccgggacgctgcctgcacaccaccccggcccctcaggagcccccga
gatgcctaccagtttggggggcccttgccctgtcacctagagtttgcccacgtcccggcc
cccccgggggactggtcccaggtctcgatgctggtccgccctcgcgccccccgaggactc
ctgctcctcgccgcccctctcacggccggcggcccctccctgcttctcctcctgagccac
ggacgctttgtcgctcagacggaaggtcccgggccccggctccgtgtccagagccgccgg
cgttcacgggctggccggtggcacatggtgtctgtgcggtgggagaagactcggatccaa
ctggtgatagacggggtccgggcccaggaccgggagcggcctggccagcagcgccgggag
ccggggagcccccggccccgaactctcttcgtggggggccttcctgccagtggcttcagc
cctaggcccccagtggccgtcagcggcttcagcggctgtgtgaggagactgaggctggat
gggcggcctctggggccccccacacgggtggtgggggtcacgccatgcttctccggcccc
ctggagaagggcctgttcttcgcagagagcgggggagtcgtcaccgcagacaccctgggg
atcacccttcttgacgtgagcctggagctggaggtacggccccgggccgcttccggcctc
ctcttccacctgggccggggccgggcgcccccctacctgcagctgcagctgcgagagaag
gaggtcctgctgcgggcggacgacggtggcggggagttctccacgtgggtgacgtgccct
gcagccctgtgtgacgggcagtggcaccgactggcagtgaccaaaggcgggaataccctc
cggctgacggtggacacacagaccaacggcacccgaggccccacggtggcagtggcctca
ggggacgccctggcccctctgcactttgggggcctgcccgggcccacgaacacacaggct
gggcctctggcctaccatggctgcatgaggaacctggtggtgaaccggtcccccgtcacc
tggcctcgctctgtgggtgttcagggggcagtgggggccagtggctgccccgccacctag

KEGG   Felis catus (domestic cat): 101086907
Entry
101086907         CDS       T02385                                 
Symbol
LAMA4
Name
(RefSeq) laminin subunit alpha-4 isoform X2
  KO
K06241  laminin, alpha 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05143  African trypanosomiasis
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101086907 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101086907 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101086907 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086907 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101086907 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101086907 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101086907 (LAMA4)
   05145 Toxoplasmosis
    101086907 (LAMA4)
   05143 African trypanosomiasis
    101086907 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_EGF Laminin_G_3 BORCS6 Allexi_40kDa
Other DBs
NCBI-GeneID: 101086907
NCBI-ProteinID: XP_003986521
Ensembl: ENSFCAG00000006308
LinkDB
Position
B2:complement(103802072..103948471)
AA seq 1906 aa
MGVPWRGSKLRARGAGRPGTGPSSLCEMPFGVGGPGRGSCASGRLDFPHPDKAGAEKVMH
ARHRRPTGAPTRTHSRRAPRSALLDGSGEMAVSSAWRPVLRLWLLWGAACAAAAAGDDSA
FPFDIEGSSAVGRLDPPEASEPRVAPGRLPPAAEKCGAGSFLAQSGACMPCDCNGNSNEC
LDGSGLCMHCQRNTTGEHCEKCLDGYIGDSIRGAPRFCQPCPCPLPHMANFAESCYRKNG
AVRCICKENYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCRN
CLRNTTGFKCERCAPGYYGDARVAKNCAVCNCGGGPCDSVTGECLEEGFEPPTGCDKCIW
DLIDDLRLAALSIEESKSGLLSVSSGAAAHRHVNELNSTIYLLKTKLSERENRYVLRKIQ
INNAENTMKSLLSDVEELAERESQASRRGELAQKESMDTINHATQLVEQAHDMRDKIKEI
NNKMLYYGEEQELSSEEISEKMVLAQKMLEEIRRRQPFLMQRELVDEEADEAQELLNQAE
NWQRLYNDTRSLFPVVLEQLDDHNAKLSDLQESLDQALDRVRDAEDMNRATAARQRDLEK
QHERVREQMEGVNASLKTSLDSLTTPRLTLSELDDIIKNASGIYAEIDGAKNELQGKLSN
LSNLSHDLVQEAVDHAQNLQQEADELSRNLHSSDMNGLVQKALDASNVYENIANYVSEAN
DTAELALNITDRIYDAVSGIDTQIIYHKDESENLLNQARELQAKTDPSNDEAVADTNRRV
GGALARKSALKNRLNDAIKRLQATERGDAQQRLGQSRLITEEANKTTVEVQQAAAPMAHN
LTSWSQNLQNFDSSAYNTAVASARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRI
RELIAQTRSVASKIQVSMMFDGQSAVEVHPKTSMDDLKTFTSLSLYMKPPPVKQPELAGA
ADRFILYLGSKHAKKEYMGLAIKNDNLVYIYNLGTKDVEIPLDSKPVSSWPAYFSIVKIE
RVGKHGKVFLTVPSLSSTAEEKFIKKGEFAGDDSLLDLDPEDTVFYVGGVPPNFKLPASL
NLPGFVGCLELATLNNDVISLYNFKRIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSY
AVVRDITRRGKFGQVTRFDIEVRTPADNGLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSN
GPVHLEDTLKKAQINDAKYHEISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGG
APPEILQSRTLKAHLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRA
YFSGQSFIASIQKISFFDGFEGGFNFRTLQPNGLLFYYASGSDVFSISLDNGTVVMDVKG
IKVQSADKQYHDGLSHFVITSVSPTRYELIVDQSRLGSKNAPKEKVEQTQASEKKFYFGG
SPISPQFANFTGCISNAYFTRLDRDVEVEDFQRYSEKVHTSLYACPIESSPLFLLYKKGK
NSSKPKPSQNKKGEKSKDAPSGDPASLKFPERNAPRDSYCHLSNSPRAIEHAYQYGGTAN
SRQEFEHLKGDFGEKSQFSIRLKTRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGH
KKLKIRSQEKYNDGVWHDVIFIREKSSGRLIIDGLRVLEESLPPTGAAWRIKGPIYLGGV
APGRAVKNVQINSVYSFSGCLSNLQLNGASITSASQTFSVTPCFEGPMEMGTYFSTEGGY
VVLDESFNIGLKFEIAFEVRPRSSSGTLVHGHSVSGEYLNVHMKKGQVIVKVNNGIRDFS
TSVTPKQSLCDGRWHRITVIRDSNVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPES
LLTPRLAPSRPFTGCIRHFVIDGRPVSFSKAALVSGAVSINSCPAA
NT seq 5721 nt   +upstreamnt  +downstreamnt
atgggggtcccttggaggggctccaaactgagagcgcgcggggcgggcaggccagggaca
ggcccgagctccctgtgtgaaatgccgtttggagtgggagggcctggacgtggaagttgc
gcgtcgggccgccttgacttcccacatccggacaaggcgggcgccgagaaggtaatgcac
gcgaggcaccgccgccccacgggggcaccgacgaggacgcacagccgccgagccccacgc
agcgccctgctggatggcagcggagagatggccgtgagctcagcctggcgcccagtcctg
aggctctggctcctctggggcgctgcctgcgcggccgccgcggccggggacgacagcgct
tttccttttgacattgaagggagctcagcggtcggcagactggacccgcccgaggcgagc
gagccccgcgtggctcccggaaggctgccgcccgctgccgagaaatgtggtgccgggtcc
tttctcgcccagtcgggagcatgcatgccctgtgactgcaacggcaattccaacgagtgc
ttggatggttctggactctgtatgcactgccagcggaacacaacaggagagcactgtgag
aaatgtctagatggttatatcggagattccatcaggggagcaccccggttctgccagcca
tgtccctgtcctttgccccacatggccaattttgcagaatcctgctatagaaaaaacgga
gccgttaggtgtatttgtaaagaaaactatgctggacctaactgtgaaagatgtgccccg
ggttactatggaaaccccttgctgattggaagcacctgtaagaaatgtgactgcagtgga
aattcagatcccaacctgatctttgaagattgtgacgaggtcaccggccagtgtaggaat
tgcctacgcaacaccacgggattcaagtgtgaacgctgtgcccctggctactatggggat
gccagggtcgccaagaactgcgcagtgtgcaattgtgggggaggcccatgtgacagcgta
accggagagtgcttggaagaaggttttgaaccccctacaggctgtgataagtgcatctgg
gatctgatcgatgaccttcggttagcggcactctctatcgaagaaagcaaatcgggtctg
ttgagcgtatcatcgggagccgctgctcataggcacgtgaatgaactcaactccaccatc
tacctcctcaaaacaaaattgtcagaaagagaaaaccggtatgtcctaagaaagatacaa
atcaacaatgctgagaacacaatgaaaagccttctgtctgatgtggaggaattagcggaa
agggaaagtcaagcctcaagaaggggcgaactggctcagaaggaaagcatggataccatc
aaccacgccacgcagcttgtggagcaagctcatgatatgagggataaaattaaagagatc
aacaacaagatgctctattatggggaggaacaggaacttagctctgaggaaatctctgag
aagatggtgttggcccagaagatgcttgaggagatcagacgccgtcaaccattcctcatg
cagcgggagctagtggacgaggaggcagatgaagcccaggaactgctgaaccaagctgag
aactggcagcggctgtacaatgatactcgctccctgtttcctgttgtgctggagcagctg
gatgaccacaatgctaagttgtcagacctccaggaatcacttgaccaggcccttgaccgc
gtcagggacgccgaagacatgaacagagccacagcagccaggcagcgggacctcgagaaa
caacacgagagagtgagggaacagatggaaggggtgaatgcttctctgaagacgtctttg
gattctctgacaacaccccgtctgaccctttcagaacttgatgatataataaagaatgca
tcagggatttatgcggaaatagacggagccaaaaatgaactacaaggaaagctctccaac
ctaagtaaccttagtcatgatttagtccaagaagccgtcgaccatgcccagaaccttcaa
caagaggctgatgaattgagcaggaatttgcacagttcagatatgaacgggctggtacag
aaggctttggacgcttcaaatgtctatgaaaatattgccaattatgttagcgaagccaat
gacacagcagaattggctttgaacatcactgaccgaatttatgatgctgtgagtgggatt
gatactcaaattatttaccataaggacgagagcgagaacctcctcaatcaagcccgagaa
ctacaagcaaagacagaccctagtaatgatgaggcagtagctgataccaacaggcgtgtg
ggtggagctctagcaaggaagagtgctcttaaaaacagattgaatgatgccattaagcga
ctgcaagccacagagagaggtgatgctcagcagcgcctgggtcagtcaaggctgatcacg
gaggaagctaacaagaccacagtggaagtccagcaggcagccgccccgatggctcacaat
ctgaccagctggtcgcaaaatctgcagaattttgactcttctgcttacaacactgcagtg
gcctctgccagagatgcagtaagaaatttgacagaggttgtccctcagctcctggatcag
cttcgcaccgtagaacagaagcggcctgcaagcaacgtttctgccagcatccagaggatc
cgggagcttattgctcagaccagaagcgtcgccagcaagatccaagtctccatgatgttc
gatggccagtcagcagtggaggtacaccccaaaaccagtatggatgacttaaagaccttc
acgtccctgagcctgtacatgaagcctcctcccgtgaagcagccagaactggcgggggct
gcagaccggtttatcctgtacctcggaagcaaacacgccaaaaaagaatacatgggtctt
gcaatcaaaaatgataacttggtgtacatttacaatttgggaactaaggatgtggagatt
cccctggactccaaacccgtcagttcctggcctgcttacttcagcattgtcaagattgaa
agggtaggaaaacacggaaaggtgtttttaacagtcccaagtctaagtagcactgcagag
gaaaagtttattaaaaagggagaattcgcaggagatgactccttgctggatctggacccc
gaggacaccgtgttttatgttggtggagtgcctccaaacttcaagctccctgcaagctta
aacctgcctggcttcgtcggctgcctggaattggccactttgaataatgatgtgatcagc
ttgtacaacttcaagcgcatctataacatggatccctccaagtcagtgccctgtgccaga
gacaaactggccttcactcagagtcgggctgccagctatttcttcgatggctccagttat
gccgtggtgagggatatcacaaggagagggaagttcggtcaggtgactcgctttgacata
gaagttcgaacgccagctgacaacggcctcgtgctcctgatggtcaatgggagtatgttc
ttcagcttggaaatgcgcaacggttacctacatgtgttctatgactttggatttagcaac
ggccctgtgcatcttgaggacacgttgaagaaagctcaaattaatgatgccaaataccat
gagatctcaatcatttaccacaatgataagaaaatgattttggtggttgacagacgacat
gtcaagagcatggacaatgaaaagatgaaaataccttttacagacatatacattggaggg
gctcccccagaaattttacaatccaggaccctcaaagcacaccttcccctagatatcaac
ttcagaggatgcatgaagggtttccagttccaaaagaaagatttcaatttattagagcag
acggaaaccctgggagttggttatggatgcccagaagactctctcatatctcgcagggca
tatttcagtggacagagtttcattgcttccattcagaaaatatctttcttcgatggcttt
gaaggaggtttcaatttccgaacgttacagccaaatgggttactattttattatgcctca
gggtcagatgtgttctccatttcgttggacaacggcactgtggtcatggatgtaaagggg
atcaaggtgcagtcggcagataagcagtaccatgacgggctgtcccacttcgtcattacc
tctgtctcacccacaagatatgaactaatagtagatcaaagcagacttgggagcaagaac
gctcccaaagagaaggtggaacagacgcaagcaagtgaaaagaagttttacttcggtggc
tcacccatcagtccccagtttgctaatttcactggctgtataagtaatgcctactttacc
aggttggatagagatgtggaggtagaagattttcagcggtactctgaaaaggtccacact
tctctgtatgcgtgtcctattgagtcttcgccattgttcctcctttacaaaaaaggcaaa
aattcctcaaagcccaaaccaagtcagaataaaaagggagaaaaaagtaaagatgcgcct
tcaggggatcctgccagcctgaagttcccagagcggaatgctcccagagattcctactgc
cacctttccaacagtcctagagcaatagagcacgcctatcagtatggagggaccgccaac
agccgccaagagtttgaacacttaaaaggagattttggtgaaaaatctcagttttccatt
cgtctgaaaactcgttcctcccatgggatgattttctatgtgtcagatcaagaagagaat
gacttcatgactctattcttagcccatggccgcttggttttcatgtttaatgttggccac
aagaaactgaagattagaagccaagagaaatacaatgatggagtgtggcatgatgtgata
tttattcgggaaaagagcagcggccgactgataattgatggcctccgagtcctagaagag
agtcttcctcctactggagctgcctggagaataaagggtcctatttatttaggaggtgtg
gctcctggaagggctgtgaaaaatgtccagataaactcagtctacagtttcagcggctgc
ctcagcaatcttcagctcaacggggcctcgatcacctctgcatctcagacatttagcgtg
accccttgttttgaaggtccgatggaaatgggaacgtacttttcaacagaaggaggatac
gtggttctagatgagtctttcaatattggactgaagtttgagattgcatttgaagtccgt
cccaggagcagttccggaaccctcgttcatggccacagtgtcagcggagagtacctaaat
gttcacatgaaaaaggggcaggtcatagtgaaagtcaacaatggcatccgagacttttcc
acctcagtgacacccaagcagagtctctgtgatggcagatggcacagaattacagttatt
agagattcaaacgtggttcagttggatgtagactccgaagtcaaccacgtggttggaccc
ctgaatccaaaaccagttgatcacagggagcctgtatttgttggaggtgttccagagtct
ctgctgaccccgcgcttggcccccagcagacccttcacaggctgcatccgtcactttgtg
attgacgggcggcccgtgagcttcagtaaagcagccctggtcagcggcgccgtgagcatc
aactcttgcccagcagcctga

KEGG   Felis catus (domestic cat): 101088641
Entry
101088641         CDS       T02385                                 
Symbol
LAMB3
Name
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101088641 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101088641 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101088641 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088641 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101088641 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101088641 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101088641 (LAMB3)
   05145 Toxoplasmosis
    101088641 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II ATG16 Leu_zip
Other DBs
NCBI-GeneID: 101088641
NCBI-ProteinID: XP_019677441
Ensembl: ENSFCAG00000015132
UniProt: M3WM02
LinkDB
Position
F1:35413459..35452684
AA seq 1172 aa
MRPLLLLGFVLPSFLCAQQACSRGACYPPVGDLLIGRTRFLHASSTCGLTKPETYCTQYG
EWRMKCCKCDSRLPHNYNGHRVENVVSSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQDIM
MDFKGSLPAGMLIERSADFGNTWQVYQYLAADCASVFPRVRQGQPQSWQDVRCQSLPQRP
NGHLDGGKVQLNIMDLASGIPATQSQKIQELGEITNLRINFTRLAPVPQRGYHAPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASSSPSTAVQVHDICVCQHNTAGPNCERCAPFYNNR
PWRPADDQDPHECQPCDCNGHSETCHFDPAVFAASQGAHGGVCDDCRDHTEGKNCERCQL
HYFRNRRPGAPIQETCIPCECDPDGAVPGVPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSHRDMPCDEESGHCLCLPHVVGPKCDQCAPYHWKLASGRGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCDAAALRQCPDRTYGDTGTGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCDRYPVCVACHPCFQSYDADLRGQALRLS
GLRNATASLWPGLGLEDPSLTARIMGAKSKMEQIQAILASASVTEQEVSQVANAIFSIRR
TLQGLQPDLALEEETLSLPGDLENLDRSFNRLLIIYQSKKEQFERLSSTDPLGALRVLTA
AYQRSSQAAQQVSDGFHLLLQLRDSRREAERLEGQVGGGTGAGGPQLAALSLGMASLPDL
MPTINKLCGGSRQTACTPGACPGELCPRDNGTACGSHCRGVLPKAGGAFRTAGQVARQLQ
GFNTQLQQTRQMIRAAEEAASKVQSDAQRLETQVSASRSQMEEDVRRTRHLIQQVRDFLS
DPDTDAATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKKDIARAR
RLQAEAEQARSRAHVVEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQERVAEVQQ
VLGPAERLVAGMTEQLGDFRARMEALRLQARQQRAQAAQAQQLAEGAEQQALSAQEGFER
IKQKYAELKDQLGRSPMLGEQGSRILSVKTEAEELFGETMEMMDRMKDMELELLRGSQAI
ELRSADLTGLEKHVEQIRDHINGRVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaggccactcctactcctgggttttgtcttgcccagtttcctgtgtgcccagcaagcc
tgctcccgtggggcctgctatccacccgttggggacctgctcattgggaggacccggttt
ctccatgcttcatccacctgtggactgaccaagcctgagacctactgcacccagtatggt
gagtggcggatgaaatgttgcaagtgtgactccaggctgcctcataattacaacggccac
cgagtggagaatgtagtttcatcctcaggccccatgcgctggtggcagtcccagaatgat
gtgaatcctgtctctctgcagttggacctggacaggaggttccagcttcaagacatcatg
atggattttaaggggtccttgcccgccgggatgctgattgagcggtccgcagacttcggc
aacacctggcaggtgtaccagtacctggctgctgactgcgcctctgtcttcccccgggtc
cgtcagggccagcctcagagctggcaggatgttcggtgccagtccttgccccagaggcct
aacgggcatctggacggggggaaggttcaacttaacatcatggatttagcatctgggatt
ccagcaactcaaagtcaaaaaattcaagagctgggggaaatcacaaacttgagaatcaac
ttcaccaggctggcccctgtgccccagagaggctaccacgcccccagcgcctactatgca
gtgtcccagttgcgtctacaggggagctgcttctgtcatggccacgctgaccgctgtgcc
cctaagcctggagcctcttccagcccctctaccgctgtgcaggtccacgatatctgtgtc
tgtcaacacaacaccgccggccccaattgtgaacgctgtgcgcccttctacaacaatcgg
ccctggagacctgcagatgaccaggacccccatgagtgccaaccctgcgactgcaacggg
cactctgagacctgtcacttcgacccagctgtgttcgccgctagccagggggcgcacgga
ggtgtgtgtgacgactgccgggaccacaccgagggcaagaactgtgagcggtgtcagctg
cactatttccgcaaccggcgtcctggagctcccattcaagagacctgtatcccctgcgag
tgtgatcccgatggggcagtgccgggcgttccctgcgacccagtgactgggcagtgcgtg
tgcaaggagcatgtgcagggggagcgctgtgacctgtgcaagccgggatttacaggactc
acctatgctaacccacagggctgccaccgctgtgactgcaacatcctggggtctcatcgg
gacatgccgtgtgatgaggagagcgggcactgcctgtgtctgccccacgtggtgggcccc
aaatgtgaccagtgcgctccctaccactggaagctggccagcggtcggggctgtgagccg
tgtgcctgtgaccctcacaactccctcagcccccagtgcaaccagttcacagggcagtgc
ccctgtcgagaagggttcggtggcctgacctgcgatgctgcagccctccgccagtgtcct
gaccggacctatggagacacaggcacaggatgccgtgcctgtgactgtgacttccgggga
acagagggcccaggctgtgacaaggcctcgggccgctgcctctgccgccctggcttgact
ggaccccgctgtgaccaatgccaacgagggtactgtgaccgctatccagtgtgtgtggcc
tgccacccttgcttccagagctacgatgctgacctccgggggcaggccttgcgcctcagc
ggcctgcgcaatgccactgccagcctgtggccagggctgggtctggaggatcctagcctg
actgcccggatcatgggtgcaaagagcaagatggagcagatccaagcaattctcgccagt
gcctcggtcaccgagcaggaggtgtcccaggtggccaatgccattttctccatcaggcgg
actctccagggcctgcagcctgatctggccctagaggaggagaccttgtccctcccggga
gacctggagaatctggacagaagcttcaatcgcctgctcattatatatcagagcaagaag
gaacagtttgaaaggctaagcagtacggatcctttaggggccttgcgggtgctgactgca
gcctaccagcggtcctcccaggctgctcagcaggtctccgacggcttccacctgctcctc
cagctcagggacagccggagagaggcagagaggctggaggggcaggtgggaggaggaacg
ggagccggaggtccccagctcgcagctctgagcctggggatggcttccttgcctgatctg
atgcccaccatcaacaagctctgtgggggctccaggcagacggcctgtaccccaggagcg
tgccccggagagctgtgtccccgagacaacggcacagcatgtggctctcactgcagaggc
gtcctccccaaagcgggtggggccttccggactgcgggccaggtggccaggcagctgcag
ggtttcaacacccagctccagcagaccaggcagatgatcagggcagcagaggaggccgcc
tcgaaggtgcagtcagacgctcagcgcctggagacccaggtgagtgccagccgctcccag
atggaggaagatgtcagacgcacacgacacctcatccagcaggtccgagacttcctgtca
gaccctgacactgatgcggccaccatccaggaggtcagcgaggccgtgctggccctgtgg
ctgcccacagactccgccaccgtcctgcagaagatgaatgagatccaggccatcgcagcc
aggctacccaatgtggacctggtgctgtcgcagaccaagaaggacattgctcgggctcgt
aggctccaggctgaggctgagcaggccaggagccgagcccacgtggtggagggccaggtg
gaggatgtggtggggaacctgcgtcagggcacagtggcactgcaggaggctcaggacacc
atgcaaggcaccagccgctcccttcggcttatccaggaaagggttgctgaggttcagcag
gtgctggggccagcggaaagactggtggccggcatgacggagcagctgggtgacttccga
gcacggatggaggcgctccgcctgcaggctaggcagcagcgggcacaggcagctcaggcc
cagcagctcgcggaaggcgctgaacagcaggcgctgagcgcccaggagggatttgagaga
ataaagcaaaaatatgctgaattgaaggaccagttgggtcgtagccccatgctgggggag
cagggaagccggatcctgagcgtcaagacagaggcagaggagctgtttggggagaccatg
gagatgatggacaggatgaaagacatggagctggagctgcttcgggggagccaggccatc
gagcttcgctcggcagacctgacggggctggagaagcacgtggaacagatccgcgaccac
atcaatgggcgtgtgctctactatgccacctgtaagtga

KEGG   Felis catus (domestic cat): 101089571
Entry
101089571         CDS       T02385                                 
Symbol
LAMC2
Name
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101089571 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101089571 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101089571 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101089571 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101089571 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101089571 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101089571 (LAMC2)
   05145 Toxoplasmosis
    101089571 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 101089571
NCBI-ProteinID: XP_023103833
Ensembl: ENSFCAG00000010584
LinkDB
Position
F1:complement(27043330..27100784)
AA seq 1191 aa
MRALWLCGCLCVALLLPNTRATSRREVCDCSGKSSQCVFDQELHRQTGNGFRCLNCIDNT
DGVHCERCKEGFYRQRERDRCLPCNCNPRGALSARCDNSGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCTQDQRPLDSKCDCEPAGISGPCDEGRCVCKPAVTGERCDRCRPGYYHLDGGN
PEGCTQCFCYGHSANCHSSGDYSVHKIISTFHQDVDGWKAVQRYGAPAKLQWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQTLSFDYRVDRGGRHPSAHDVILEGAGLRVTAPL
MPRGKTLPCGITKTYTFRLNERPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYL
DNVTLISARPVSGAPAPWVEQCVCPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENLDIECADCPIGFYNDPHDPRSCKPCPCRNGFSCSVMPETEEVV
CNNCPHGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGVHCDRCKAGYFGDPLATNPADKCRACNCNPMGSEPGECRSDGSCVCKPGYGGL
TCEHAALTSCPACYNQVKIQMDQFRQQLQSLEALVSRAQSGGGAVPSTELEGRMRQAEQT
LQDILREAQISEGAIRSLNLQLAKARSEEKSYLSRLDDLKRAVERIRALGSQYQNRVQDT
HRLVTQMRLSLEESEASLRNTNIPPSEHYVGPNGFQSLAQEATRLADSHAASAGNMERLV
RETEDYSKQALSLARKAQREGGGRGSLEGSAVQGLMGKLEKTKSLAQQLSGEATQADIEA
DRSYQHSLRLLNSMSQLQGVSDQSFQVEAKRIRQKADSLSGLVTRRMEEFKHMQSNLRNW
EEETQQLLQNGKNGRQKSDQLLSRANLAKSKAQEALSMGNSTFYEVENILKNLREFDLQV
EDRKAEAEEAMKRLSYISQKVASASDKTKQAEAALGGAAADAQRAKTAANEALEITDKIE
QEIGSLNLEANVTADGALAMEKGLAILKSEMREVEGELARKEQEFDLDMDTVQMVITEAQ
RVDNRAKNAGATIQDTLNTLDSILDLMDQPGSVDEEGLILLEQKLFRAKTQINSQLRPLV
SELEDRARRQQRHLRLLETSINGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgcgcgcgctctggctgtgcggctgcctctgcgtcgcgctgctcctgcccaacacccgg
gccacctccaggagggaagtctgtgattgcagtgggaagtccagccaatgcgtctttgac
caggagcttcacagacagacaggcaacgggttccgttgcctcaactgcattgacaacacc
gatggcgttcactgcgagaggtgcaaggaggggttctaccgacagagagagagggatcgc
tgcttaccctgcaactgtaaccccagaggtgctctcagcgctcgatgtgacaactctgga
cggtgcagctgtaaaccaggtgtgacaggagacaggtgtgaccggtgtctgccaggcttc
cacacactcaccgatgctgggtgcacccaggaccagaggccactagactccaagtgtgac
tgcgagccagctggcatctcggggccctgtgacgaaggccgctgtgtctgcaagccagct
gtcaccggagagcgctgtgataggtgtcgaccaggttactatcacctggatgggggaaac
cccgagggctgcacccagtgtttttgctatgggcattcagccaactgccacagctctgga
gactacagtgtccataaaatcatctctactttccatcaagatgttgacggctggaaggct
gtccaaagatatggggctcctgcaaagctgcagtggtcacaacgccatcgagatgtgttt
agctctgcacgacgatcagaccctgtctactttgtagctcctgccaaatttcttgggaat
caacaggtgagctatgggcaaaccctgtcctttgactaccgtgtggacaggggaggcaga
cacccatctgctcacgatgtgatcctggaaggtgctggtctgcgggtcacagctcccttg
atgccacgtggcaagacactgccatgtgggatcaccaagacttacacgttcaggttaaat
gaacgcccaagcagtaactggagcccccagctgagttactttgagtatcggaggttactg
cgtaacctcacggccctgcggatccgagctacctatggagaatacagtactgggtacctt
gacaacgtgaccctgatttcagctcgccccgtctccggagccccagcaccctgggttgaa
caatgcgtatgtcccgttgggtacaaagggcagttctgccaggattgtgcttctggctac
aaaagagattctgccagactgggaccttttggcacctgtattccatgtaactgccaaggg
ggaggagcctgcgatccagacacaggagattgttattcgggggatgaaaatcttgacatc
gaatgtgccgactgccctattggtttctacaacgatccacacgacccccgcagctgcaag
ccgtgcccctgccgcaacgggttcagctgctccgtgatgcccgagacagaggaggtggtg
tgcaataactgcccccacggggtcaccggtgcccgctgcgagctctgtgctgatggctac
tttggggacccatttggggagcatggcccagtgaggccttgtcagccctgtcagtgcaac
aacaacgtggatcccagtgcttccgggaactgcgaccgcctgacaggcaggtgtctgaag
tgcatccacaacacagctggtgtccactgtgaccggtgcaaagcaggctactttggggac
cctttggctaccaacccagcggacaagtgtcgagcttgcaactgcaacccaatgggctca
gagcctggggagtgccgaagtgatggcagctgtgtttgcaagccagggtatggcggcctc
acctgtgagcatgcagcattaaccagctgcccagcttgctataatcaagtgaagattcag
atggaccagtttaggcagcagctccagagcctggaggccctggtttcaagggctcagagt
ggtggtggagcagtgcccagcaccgagctggaaggcaggatgcggcaagctgagcagacc
cttcaggacattctgagagaagcccagatttcagaaggtgctattagatctctcaatctc
cagctggccaaggcaaggagtgaagagaaaagctacctgagccgcctggatgacctcaag
agggccgtggaaagaattcgggccctgggcagtcagtatcagaaccgagttcaagatact
cacaggctggtcacgcagatgcgcctgagcctggaggaaagcgaggcctccctgagaaac
actaacattcctccctcagagcactacgtggggccaaatggttttcaaagcctggctcag
gaggccacaagattggcagacagccatgctgcgtcagccggtaacatggagcggctggtg
agggaaaccgaggactattccaaacaagcgctgtcgctggcacgcaaggctcagcgggaa
ggaggcggaaggggcagcctggagggctctgcggtgcaaggccttatgggaaagttggag
aaaaccaagtccctggcccagcagctgtctggggaggccactcaagctgacattgaggca
gacaggtcttatcagcatagccttcgccttctcaattccatgtctcagcttcagggagtc
agtgatcagtcttttcaggtagaagcaaaaaggatcagacaaaaagcagattctctctca
ggcctggtgactagacgtatggaggagttcaagcacatgcaaagcaatctgagaaactgg
gaagaagaaacccagcagctcttacagaacggaaagaatgggagacagaaatcagatcag
ctgctttcccgtgccaacctcgctaaaagcaaagcccaagaagcactgagtatgggcaat
tccactttttatgaagttgagaacatcttgaagaatctcagagagtttgacttgcaggta
gaagacagaaaagcagaagccgaagaggccatgaagagactctcgtatatcagccagaag
gttgcaagcgctagtgacaagactaaacaggcagaagcagccctgggcggtgctgctgcc
gatgcccagagggcaaagaccgcagccaacgaggccctggagatcacggacaagatagaa
caggagatagggagtctgaacttggaagccaatgtgacagcagatggagccttggccatg
gagaagggactggccattctgaagagtgagatgagggaagtggaaggagagctggcaagg
aaggagcaagaatttgacctggatatggacacagtacagatggtaattacagaagcccaa
agagttgataacagagccaagaatgctggagctacgatccaagacaccctcaacacgttg
gacagcatcttagatctaatggaccagcctggcagtgtggatgaagagggactgatctta
ctggagcagaaactcttccgagccaagactcagatcaacagccagctgcggcccttggtg
tcagagctggaagatcgagcacgtcggcagcagcgccaccttcgtttgctggagacgagc
atcaacgggattctggctgatgtgaagaacctggagaacatcagggacaacctgccgcca
ggctgctataatacacaggctcttgagcaacagtga

KEGG   Felis catus (domestic cat): 101090321
Entry
101090321         CDS       T02385                                 
Symbol
LAMC1
Name
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05020  Prion disease
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101090321 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101090321 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090321 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090321 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101090321 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101090321 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101090321 (LAMC1)
   05145 Toxoplasmosis
    101090321 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    101090321 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 101090321
NCBI-ProteinID: XP_011289352
Ensembl: ENSFCAG00000024895
LinkDB
Position
F1:complement(27131570..27261176)
AA seq 1608 aa
MRGSERAAPALRPRGRLWPVLAVLAAAAAGCARAAMDECTDEGGRSQRCMPEFVNAAFNV
TVVATNTCGAPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFN
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRST
GHGGHCTNCQGNTDGAKCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSIDECNVETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFQIDEDGWHVEQRDGSEASLEWS
SERQDVAVISDSYFPRYFIAPAKFLGKQLLSYGQNLTFSFRVDRRDTRLSAEDLVLEGAG
LRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPPLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLTSARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPETGVCDCRDNTAGPHCEKCGDGYYGDSTAGTSSDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNALAPNPADKCKACDCHPYGTVKQQRGCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRSGQCECQPGIT
GQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFY
NRSRPGCQECPACYRLVKDKVADHRMKLQELENLIANLGTGEEVVTDQAFEDRLKEAERE
VMDLLREAQDVKDIDQNLIDRLQRLNNTLSSQISRLQNIRNTIEETGNLAEQARARVEST
EQLIEIASRELEKAKIAVANVSITQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANETSTEAYDLLLRTLAGENQTTLEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAG
DKAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDHLIDQKLKDYEDLREDMRGKELEV
KKLLEKGKIEQQTADQLLARADAAKAVAEEAAKKGRNTLQEANDILSNLRDFDRRVNDNK
TAAEEALRRIPAINQTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQRNAT
STKAEAEKTFAEVTDLDNEVNDMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEI
NARKAKNSVTSLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDL
ENEARKQEAAIMDYNRDIEEIMKDIRNLEDIKKTLPSGCFNTPSIEKP
NT seq 4827 nt   +upstreamnt  +downstreamnt
atgaggggcagcgagcgggccgcgccggcgctgcggccccgggggcggctctggccggtg
ttggcggtgctggcggccgccgcggccggctgtgcccgggcagccatggacgagtgcacg
gacgagggcgggcggtcgcagcgctgcatgcccgagttcgtcaacgccgccttcaacgtg
accgtggtggccaccaacacgtgcggggctccgcccgaggagtactgtgtgcagaccggg
gtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcagcac
ggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccag
accatgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaa
gcttttgacatcacatacgtgcgcctcaagttccacaccagccgcccggagagcttcgcc
atttacaagcgtacacgggaagatgggccctggattccttaccagtattacagcggctcc
tgcgagaacacctactcgaaggcaaaccgcggcttcatcaggacaggaggagatgagcag
caggccttgtgcacagatgaattcagtgatatttcccctctgactggaggcaatgtggcc
ttttcaaccctagaaggaaggccgagtgcctacaacttcgacaatagtccggtgctgcag
gaatgggtaactgccactgacatcagagtcacactcaatcgcctgaacacctttggagat
gaagtgtttaacgatcccaaagttctcaagtcctactattatgcaatctctgattttgct
gtgggtggtaggtgtaaatgtaacggacatgcaagcgagtgtgtaaagaacgaattcaac
aagctggtgtgtaattgtaaacataacacttacggagtggactgtgaaaagtgtctgcct
ttcttcaatgaccggccgtggaggagggcgaccgccgagagtgccagcgaatgcctgccc
tgtgactgcaatggccgatcacaagaatgctactttgaccctgaactataccggtccacc
ggccatggtggccattgcaccaactgccagggcaacacggatggtgccaaatgtgagagg
tgccgggagaatttcttccgccttgggaacaacgaagcctgctctccgtgtcactgtagt
cctgtgggttctctcagcacacagtgtgatagctatggcaggtgtagctgtaagccagga
gtgatgggtgataagtgtgaccgctgccagcctggataccattctctcactgaggcagga
tgcaggccatgctcttgtaatccttctggcagcatagatgaatgtaatgttgaaacagga
agatgtgtttgcaaagacaatgttgaaggcttcaattgtgagaggtgcaaacctggattt
tttaatctggaatcatctaatcccagaggttgcacaccctgcttctgctttgggcattct
tctgtctgtacaaatgctgtcggctacagtgtttattctataacctctacctttcagatc
gatgaggatgggtggcatgtagaacaaagggatggctctgaagcatcactcgagtggtcc
tcagagaggcaggatgtcgccgtcatctcagatagctactttcctagatacttcattgct
cctgcgaagttcctgggcaagcagttgttgagttatggccagaacctcaccttctccttt
cgagtggacaggcgagacactcgcctgtctgcagaagacctggtgcttgaaggagctggc
ctgagagtgtctgtgcccttgatcgctcagggcaattcctatccaagtgagaccactgtg
aaatacgtcttcaggctccatgaagcaacagattatccttggaggcctcctcttacacct
tttgaatttcagaagctcctaaacaatttgacctccatcaagatccgtgggacatacagt
gagagaagtgctggctatttggatgatgtcaccctgacaagcgctcgccccgggcctggg
gtgcctgcaacgtgggtggagtcttgtacctgtcctgtgggatacggagggcagttttgt
gagatgtgcctctcaggttacagaagagaaactccgagtctcgggccatacagcccgtgt
gtgctctgtacctgcaatggacacagtgagacctgtgaccctgagacaggtgtttgcgac
tgcagagacaatacagctggaccccactgtgagaagtgcggtgacgggtactatggagat
tcgaccgcgggcacctcttccgattgccagccctgtccgtgtcctgggggctcgagttgt
gccgttgtccctaagactcaggaggtggtgtgcaccaactgtcccactggcaccactggt
aaaagatgtgagctctgtgacgatggctactttggagaccctctggggagaaacggcccc
gtgaggctttgccgcctctgccagtgcaatgacaacatcgatcccaatgccgttggaaat
tgcaatcgcttgacaggagaatgcctgaaatgcatctataacactgctggcttctattgt
gaccgatgcaaagatggattttttggaaatgccctggcccccaatccagcagacaaatgc
aaagcctgtgactgccatccctatggaaccgtgaagcagcagagaggctgtaaccctgtg
accgggcagtgcgaatgtctgccccacgtgactggccgggactgtggggcctgtgacccc
ggcttctacaacctgcagagtgggcaaggctgcgagaggtgtgactgccatgctttgggt
tccaccaatggacagtgtgacatccgcagtggccagtgtgagtgccagcctggcatcacc
ggtcagcactgcgagcgctgtgaggtcaaccacttcgggtttggacccgaaggctgcaaa
ccgtgtgactgtcatcccgagggatctctttcactccagtgcaaagacgatggtcgctgt
gaatgcagagaaggttttgtgggaaatcgctgtgaccagtgtgaagagaactatttctac
aatcggtctcggcctggctgccaggaatgtccagcatgttatcggctggtgaaggataag
gttgctgatcatcgaatgaaactccaggaattagagaatctcatagcaaaccttggaact
ggggaagaggtggtgacagatcaagcctttgaggacaggctaaaggaagcagagagagaa
gttatggacctccttcgagaggcccaggatgtcaaagatatagaccagaatttgatagat
cgcctccagagattgaataataccttatccagccaaattagccgtttacagaatatacgg
aataccattgaagagactggaaacttggctgagcaagcacgtgccagggtagaaagcact
gagcagttgattgaaattgcatcccgagaacttgagaaagcaaagattgctgttgccaat
gtgtcaatcactcaaccagagtccaccggggacccaaacaacatgactcttttggctgaa
gaggcacgaaagcttgctgaacgccataaacaagaagctgatgatattgtaagagtggca
aagacagctaatgagacatcaactgaggcatatgatctgcttctgagaacactggcagga
gagaatcaaacaacactggagattgaggagcttaatagaaagtatgaacaagcaaagaac
atctcacaggatctggagaagcaagctgcccgagtgcatgaagaggccaaaagggctgga
gataaagcggtggagatctatgccagcgttgcccagctgacgcctgtggactcagaagca
ctggagaatgaggcaaataaaataaagaaggaagctgaggatctggaccatctgattgac
cagaagttaaaagattatgaggacctcagagaggacatgagagggaaggaactggaagtc
aagaagcttctggaaaagggaaagattgaacagcagactgctgaccagctcctagcccga
gcagatgccgccaaggctgttgccgaagaagctgctaaaaagggacgaaataccttacaa
gaagccaacgacatcctcagcaacctgagagattttgacaggcgtgtgaacgataacaag
acagctgcagaggaggctctaaggagaattcctgccatcaaccagaccataattgaagcc
aatgaaaagacgagggaggcacagctggccctgggcaatgccgctgcggatgccaccgaa
gccaagagcaaggcccacgaggccgagaggatcgccagtgctgtccaaaggaatgctacc
agcaccaaggcagaagctgaaaagacatttgcagaagttacagacctggataacgaggtg
aacgatatgttgaaacaactacaggaagcagaaaaggagctgaagagaaaacaagatgat
gctgaccaggatatgatgatggcagggatggcttcacaggctgctcaggaagccgagatc
aatgccagaaaagccaaaaactctgtcaccagcctcctcaacctgattaatgacctcttg
gagcagctggggcagctggacacagtggacctgaacaagctgaatgagattgaaggtacc
ctgaacaaagccaaagatgagatgaaagtcagcgatctagacaggaaagtatctgacctg
gagaatgaagcgaggaagcaggaggctgccatcatggactataacagagatatcgaggag
atcatgaaggacattcgcaacctggaagacatcaagaagaccctaccgtctggctgcttc
aacaccccgtccattgaaaagccctag

KEGG   Felis catus (domestic cat): 101092612
Entry
101092612         CDS       T02385                                 
Symbol
LAMA2
Name
(RefSeq) LOW QUALITY PROTEIN: laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101092612 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101092612 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092612 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092612 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101092612 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101092612 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101092612 (LAMA2)
   05145 Toxoplasmosis
    101092612 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101092612 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101092612 (LAMA2)
   05414 Dilated cardiomyopathy
    101092612 (LAMA2)
   05416 Viral myocarditis
    101092612 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 Cep57_MT_bd DUF948
Other DBs
NCBI-GeneID: 101092612
NCBI-ProteinID: XP_011280915
Ensembl: ENSFCAG00000005957
UniProt: A0A5F5XHA4
LinkDB
Position
B2:119066050..119690247
AA seq 3125 aa
MPGAAGVLLVLLLSGGLGGGQAQRPQLQQRPRQPQAHQQRGLFPAVLNLASNALITTNAT
CGEKGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKN
GIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECL
TLYNIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTS
ARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACP
LDPVTNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDE
NVARRNLSLNIHGKYIGGGVCVNCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCD
PIGSLNDVCVKDEKHARRGLAPGSCPCKPGFRGVSCDRCARGYTGYPDCKPCNCSGAGSA
NEDPCFGPCNCKENVEGGDCSRCKSGFFNLQEDNHKGCDECFCSGVSNRCQSSYWTYGHI
QDMSGWYLTDLSGHIRVAPRQDDSESAQQISISNVEAQRSLPQRYYWSAPALYLGNKLTA
VGGQLTFTISYDFEEEEEDTEHVLQIMVILEGSDLRISTVQDEVYLQPYEEHIHSLSLKE
ELFTIHGTNFPVSRREFMTVLANVKRVLIQITYSLGMDATFRLGSVGLESAVPYPTDGTI
ATAVEICQCPPGYSGSSCESCWPRHRRVNGTILGGICERCQCFGHAESCDDITGECLNCK
DHTGGPYCNKCLPGFYGDPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDACPV
GYTGPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRY
CELCADGYFGDAVDAKNCQPCRCNVNSSLSESCHARTGQCECKPNVQGLRCDECKPETFG
LQSGRGCVPCNCNSFGSKSFDCEESGQCWCQPGVAGKKCDRCAHGYFNFQEGGCTACDCS
HLGNNCDPKTGQCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNTNTG
QCNCHPKFSGAKCTECNRGHWNYPHCSPCECFLPGTDERTCDSETKKCSCMDQTGQCTCK
VHVEGVRCDRCRPGKFGLDAKNPLGCSSCYCFGATTQCSEAKGLIRTQVTLKPEQTILPL
VDEALQHTTTKGIVFQHPETVAHMDLVRQELHLEPFYWKLPEQFEGKKLTAYGGKLKYAI
YFEAREETGFSTYNPQVIIRGGTPTHARIIIRHMAAPLIGQLTRHEIEMTEKEWKYYGDD
PRISRTVTREDFLDILYDIHYILIKATYGNIMRQSRISEISMEVAEQGRITAVTPPARLI
ERCDCPPGYSGLSCETCMPGFYRLRSEPGSHTPRPTLGTCVPCQCNGHSSLCDPETSICQ
NCQHHTAGDFCERCALGYYGIVRGLPNDCQQCACPLISSSNNFSPSCVMEGLDDYRCTAC
PRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDPITGLCTCRPGATGRKC
DGCKHWHARESTECVFCGDECTGLLLGDLARLEQMAMSVNLTGPLPAPYTMLYGLENRTQ
ELKHLLSPQRAPERLIQLAEGNLNTLVMEMNELLTRATKVTADGEQTGQDAERTNRRADS
LGEFIKELAQDAEAVNEKAVRLNETLGIQDQDFERNLQGLQKEIDQMMTELRRKNLDKQK
EVAEDELVAAEGLLKKVKKFFGESREKNEKAEKDIRAILADNKDKVDAAWDLLREATDKI
REANRLSAANQKNMTALEKKKEAIENGKQQTENTLKEGNDILSEANRLADEINSVIDYVE
DIQTKLPPMSEELKDKIDDLSQEIQDRNLAEKVSQAESHAAQLNDSSAVLDGILDEAKNI
SFNATAAFNAYSNIKDSIDEAEKIAQEAKDLAHEATKLATGPQGSLKEGAKGSLQKSFGV
LNEAKKLANNVKENDDYLNGLITRLENADVKNGDLLRALNDTLAKSSAIPDDTAAKLQGV
KDKARQANDTAKHVLARIKDLHQDLDGLKKNYNQLADSIAKTNAVVKDPSKNKIIADADA
TVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRT
YKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRV
EYPDLTIDDSYWYRIEASRTGRNGTISVRALDGPKASIVPSTYHAVSPPGYTILDVDANA
MLFVGGLTGKLKKADAVRVVTFTGCMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDS
EGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELTDGH
VKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENLATLSSGNN
FGLDLKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGV
TKGCSLENVYTVSFPKPGFVELSPVPIDVGTEINLSFSTKNESGIILLGSGGTPVQPRRK
RRQTGQAYYAIFLNKGRLEVHLSMGTRTMRKIVVKPEPSLFHDGREHSVHVERTKGMFTV
QVDEDRRHMQNLTVEQAIEVKKLFVGGAPPEFQPPPLRNIPPFEGCVWNLVINSVPMDFA
QPVSFKNADIGRCAHQKPREDEGREIPAEIVTQPEPVPTPAFPTPTPVVAQGPCAAEAEP
ALLIGSKQFGLSKNSHIAIAFDDTKVKNRLTIEFEVRTEAESGLLFYMARINHADFATVQ
LRNGLPYFSYDLGSGDTNTMIPTKINDGQWHKIRIMRIKQEGIIYVDDASNRTISPKKAD
ILDVVGMLYVGGLPINYTTRRIGPVTYSIDGCIRNFQMAEAPVDLEQPTSSFHVGTCFAN
AQKGTYFDGTGFAKAVDGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGVEMIDEKL
MFHVDNGAGRFTAVYDAGIPGHLCDGQWHKVTANKIKHRIELTVDGNQVLAQSPNQASTS
ADTNDPVFVGGFPDGLNQFGLTTNIRFRGCIRSLRLTKGTGKPLEVNFAKALELWGVQPV
SCPAN
NT seq 9378 nt   +upstreamnt  +downstreamnt
atgcccggagccgccggggtcctcctggtcctgctgctcagcgggggcctcgggggcggc
caggcccagaggccacagctgcaacagcggccgcggcagccacaggcacatcagcaaaga
ggtttattccctgctgtcctgaatcttgcttccaatgctctcatcaccacaaatgcaaca
tgtggagaaaaaggacctgaaatgtattgcaaattggtagagcatgtccctggacagcct
gtgaggaacccccaatgtcgaatctgcaatcaaaacagcagcaatccaaatcagagacac
ccgattacaaatgctattgatggaaagaacacttggtggcagagtcccagtattaagaat
ggaattgaataccattatgtgacgattacactggatttacagcaggtgttccagattgct
tatgtgattgtgaaagcagctaattccccgcggcctggaaactggattttggaacgctca
cttgatgatgtcgaatacaagccttggcagtatcatgctgtgacagacacggagtgtcta
acactttacaatatttatccccgcactggaccaccatcatatgccaaagacgatgaggtc
atctgcacttcattttattccaagatacaccccttagaaaatggagagatacacatctct
ttgatcaatgggagaccaagtgccgatgacccttctcccgaactgctggaattcacctcc
gctcgctatattcgcctgagatttcagagaatccgcaccctgaatgctgacttgatgatg
tttgctcacaaagacccaagagaaattgacccgattgtcacacgaagatattactactcg
gtcaaggatatttcggtcggagggatgtgcatctgctacggtcatgccagggcttgtcca
cttgatccagtgacaaataaatcccgctgtgaatgtgagcataatacatgtggggatagc
tgtgatcagtgctgtccaggattccatcagaaaccttggagagctggcacttttctgact
aaaactgaatgcgaagcatgcaattgtcatgggaaagctgaagaatgctattatgatgaa
aatgttgccagaagaaatctgagtttaaatatacatggaaagtacattggagggggtgtg
tgcgtgaattgtacccaaaatactgctggtataaactgtgagacatgcattgatggcttc
ttcagacccaaaggggtgtctcctaattatccacgaccatgccagccatgccattgtgat
ccaattggttccttaaatgatgtctgtgtgaaggatgaaaaacatgctcggcgaggtctg
gcacctgggtcttgtccttgcaaacctggcttcagaggcgtgagttgtgatcgatgtgcc
aggggctacactggctacccagactgcaaaccctgtaactgcagtggcgcagggagcgca
aatgaggacccttgttttggaccctgtaactgcaaggagaatgttgaaggtggggactgc
agtcgctgtaaatccggcttcttcaacttgcaagaggataatcataaaggttgtgacgag
tgtttctgttcaggggtttcaaacagatgtcagagctcctactggacctatggccatata
caagacatgagcggctggtacctaactgacctctctggccacattcgagtggctccccgg
caggatgactcagagtcagctcagcagatcagcatcagcaatgtggaagcccagcgttcc
ctgccacagaggtactactggagtgcaccagctctgtatctgggaaacaaacttacagca
gttggaggacagttgacatttaccatctcatatgactttgaagaagaggaagaagataca
gaacacgttctccagattatggttatcttagagggaagtgacttgaggatcagcacagtc
caagacgaggtgtatctgcaaccatatgaagaacatatccattcattgtcacttaaagaa
gaattgtttaccatacatggcacaaatttccctgtcagtagaagagagtttatgacagtg
ctcgcgaatgtaaagagagtcctcatacaaatcacctacagccttgggatggatgccacc
ttcaggctgggctctgttggccttgaatccgcagtcccctatcctactgatggaaccatt
gcaaccgctgtggagatttgccagtgtccacctgggtattctggctcctcttgtgagtct
tgttggcctcggcacagacgagtcaatggcactattttgggtggcatctgtgaacgatgt
caatgctttggccatgcagaatcttgtgatgacatcactggagaatgcctgaactgtaag
gatcacacaggtggcccatactgcaataaatgtcttcctggtttctatggtgatcctact
aaaggaacctctgaagactgtcagccctgcgcctgtccactcaatatcccatccaataac
tttagcccgacgtgccatttagaccgaagtctcggattgatctgtgacgcatgccctgtc
gggtacacaggaccacgctgtgagaggtgtgcagaaggctattttggacaaccttctgta
cctggaggatcatgtcagccatgccaatgcaatgacaaccttgacttctccatccctggc
agctgtgacagcttgtctggctcctgtctgatatgtaagccaggtacaacaggccggtac
tgtgagctctgtgctgatggatattttggagacgcagttgatgcaaagaactgtcagcct
tgtcgctgtaatgtcaacagctccttgtccgagagttgccatgctaggacaggacagtgt
gaatgcaaacctaatgtgcaaggactgcggtgtgatgagtgtaagcctgaaaccttcggc
ctacaatctggaaggggttgtgttccctgcaattgcaattcctttgggtctaagtcattt
gactgtgaagagagtggtcaatgttggtgccaacctggagtagcaggaaagaaatgtgac
cgctgtgctcacggctatttcaacttccaggaaggaggctgcacagcttgtgattgttcc
catctgggtaataattgtgacccaaagactggtcagtgcatttgccctcccaataccatt
ggagaaaaatgttctaaatgtgcacctaacacctggggccacagcatcaccactggttgt
aaggcttgtaactgcagcacagtaggatccttggatttccaatgcaatacaaacacaggc
caatgcaactgtcatcccaaattctctggtgcaaaatgtacagagtgcaatcgaggtcac
tggaactaccctcactgcagcccctgcgagtgcttcctgccgggtactgatgaaaggacc
tgcgattcagagactaaaaagtgctcctgtatggatcagacagggcaatgcacctgtaag
gtgcatgtagaaggtgtgcgctgtgacaggtgccggccaggcaagtttggactagatgcc
aaaaacccacttggctgcagcagctgctattgcttcggcgccactacccagtgctctgaa
gccaaaggactgatccgtacgcaggtgactctgaagcctgagcagaccatcctgcccctg
gtggacgaggctctgcagcatactaccaccaaaggcatcgtttttcaacatccggagact
gttgcacatatggatctggtgagacaggagctccacctggaacccttttactggaaactt
ccagaacaatttgaaggcaagaagttgacggcctatggaggtaaactcaagtacgcgatc
tatttcgaggctcgggaagagacaggtttctccacctataatcctcaagttataattcga
ggcgggactcctactcatgctagaattatcatcaggcatatggctgctcctctaattggc
caattgacaaggcacgagattgaaatgacagagaaagaatggaaatattatggtgatgac
cctcgaatcagtagaaccgtgacccgtgaagacttcttggatattctatatgatattcat
tatattcttatcaaagcaacttatggaaatatcatgagacaaagcaggatttctgaaatc
tcgatggaggtagctgaacaaggacgcataacagcggtgactcctccagctcgtttgata
gaaagatgtgattgtcccccaggctattccggtttgtcctgtgagacatgcatgccagga
ttttatcgactacgatctgagccaggcagccatactcctagaccaaccctgggtacctgc
gttccatgtcagtgtaatggacacagcagcctatgtgaccctgaaacttctatatgccag
aattgtcaacatcacactgctggtgacttctgtgaacgatgtgctcttggatattatgga
attgtcaggggattgccaaatgactgtcagcaatgtgcttgccctctgatttcttccagc
aacaatttcagcccttcttgtgtcatggaaggccttgatgattaccgctgcacagcttgc
ccacgaggatacgaaggccagtactgtgaacggtgtgcccctggctatactggcagcccc
agcagccctggaggttcctgccaagaatgtgagtgtgacccctatggctcgctgcctgtc
ccctgtgatcctatcacggggctctgcacgtgccggcctggagccacagggcggaagtgt
gacggctgcaagcactggcatgcgcgcgagagcacggagtgcgtgttttgtggagatgaa
tgcacgggccttcttctcggtgacttggctcgcctggagcagatggccatgagcgtcaac
ctcactggcccgctgcctgccccatatacgatgctgtatggccttgaaaataggactcaa
gaactaaagcatttgctctcacctcagcgagccccagagaggctcattcaattggcagag
ggcaatctgaacacactcgtgatggaaatgaatgagcttctgaccagggcgaccaaagtg
acagcagatggcgagcaaactggacaggatgctgagaggaccaacaggagagcagactcc
ttaggagaattcattaaggagcttgcccaggatgcagaagctgtaaatgaaaaagctgtg
agactaaatgaaactctaggaattcaagaccaggactttgagagaaatttgcaagggctt
cagaaagagattgatcagatgatgactgaactgaggaggaaaaatcttgataaacaaaag
gaagttgccgaagatgagttagtggctgcagaaggccttctgaagaaggtgaagaagttc
tttggagagtcccgagagaagaatgaaaaagcagagaaggatatccgggcgatactggca
gacaacaaagataaagtggatgctgcttgggacctgttgagagaagccaccgataaaatc
agagaggctaatcgcttatctgcagcaaatcagaaaaacatgactgctttggagaaaaag
aaggaagctatcgaaaatggcaaacaacaaactgagaacactttaaaagaaggcaatgac
atactcagtgaagccaaccgtcttgcagatgaaatcaactccgtcatagattacgttgaa
gatattcaaactaagttgccacccatgtctgaggagctgaaagataaaatagatgacctc
tcccaggaaatacaggacagaaaccttgctgagaaggtgtcccaggctgagagccatgca
gctcagttgaatgactcatctgctgtccttgatggaatccttgacgaagctaaaaacatc
tccttcaatgccactgcagccttcaatgcttacagcaatattaaggactctattgatgaa
gctgagaaaattgcccaagaagccaaagatcttgcacatgaagctacaaaactggcaaca
ggtcctcagggttcattaaaggaaggtgccaaaggttctcttcagaaaagctttggggtt
cttaatgaagccaagaagttagcaaacaatgtcaaagaaaatgatgattatctgaatggc
ttaataacccgattagaaaatgcagatgttaaaaatggagatctcctgagagctttgaat
gacactttggcaaagtcgtcagccattcccgacgacacagccgctaaactgcaaggtgtt
aaggacaaagcgagacaagccaacgacacagcaaaacatgtgctggcacggattaaagat
ctccaccaggaccttgacggcctgaagaaaaattacaatcaactggcagacagcatagcc
aaaacaaatgctgtggtaaaagatccttcgaagaacaaaatcattgcagatgcagacgcc
actgtgaaaaatctagaacaagaagctgatcgtctaatagataaactcaaacccatcaag
gaacttgaggataacctaaagaaaaacatctctgagataaaggaactgataaaccaagcc
cggaaacaagccaattctatcaaagtatctgtgtcttccggtggtgactgcattcgaaca
tacaagcctgaaatcaagaagggaagctacaacaatatcgttgtcaacgtaaagacagct
gtggccgacaacctccttttttatcttggaagtgccaaatttattgactttctggctata
gaaatgcgtaaaggcaaagtcagctttctctgggatgttggatccggagttggacgcgta
gagtatccagatttgaccattgatgactcatactggtaccgtattgaggcatcaagaact
gggaggaacgggaccatttctgtgagagccctggatggacccaaagccagcattgtgccc
agtacataccacgcggtgtctcctccagggtatactattcttgatgtggatgcaaacgcg
atgctcttcgttggtggcttgactgggaaactgaagaaggccgatgctgtacgcgtggtt
acattcactggctgtatgggagaaacatactttgacagcaaacctatagggttatggaat
ttccgagaaaaagaaggtgactgcaaaggatgtactgtcagtcctcaggtagaagatagc
gaggggactattcagtttgatggagaagggtacgcattggtcagccgccccattcgttgg
taccccaacatctcaactgtcatgttcaagttcaggacattttcttcaagtgctctcctg
atgtaccttgccacacgagacctgaaagatttcatgagtgtagaactcaccgatgggcat
gtaaaagtcagctatgatctgggttcaggaatggcttccgttgtcagcaatcaaaaccat
aatgatgggaaatggaaatccttcaccctgtcaagaattcagaaacaagccaacatatca
attgtagatatagatactaaccaggaggagaacctagcaactttatcttctggaaacaac
tttggtcttgacttgaaagcagatgacaaaatatattttggtggtctgccaacactgaga
aacttgagtatgaaagcaagaccagaagtaaatttgaagaaatattcgggctgcctcaaa
gatattgaaatttcaagaactccatataatatactcagtagccctgactacgttggtgtt
accaaaggatgttcactggagaacgtttacacagtcagcttcccaaagcctggtttcgta
gagctgtcccctgtaccgattgatgtaggcacagaaatcaacctgtccttcagcaccaag
aatgagtctgggatcattctcttgggaagtggagggacgccagtacaacctcgtaggaaa
cgaaggcaaactggacaggcctattatgcgatattcctgaacaagggccgtctggaagtg
catctctccatggggacaagaacaatgaggaaaattgtcgtcaaaccagagccgagtctg
tttcacgatgggagagaacattccgttcatgtcgagaggactaaaggcatgtttactgtt
caagtcgatgaagacagaaggcatatgcaaaatctgacagtagaacaggcaattgaagtt
aagaagcttttcgttgggggtgctccacctgaatttcaacctcccccgctcagaaatatc
cctccttttgaaggctgtgtatggaaccttgttataaactctgtccccatggactttgca
cagcctgtctccttcaaaaatgcagacatcggtcgttgtgcccatcagaaaccccgtgag
gatgaaggtagagaaattccagctgaaatagttacccagccagagccagtgcccacccca
gccttccctacacccaccccagttgtggcacagggtccttgtgctgcggaagcagaacca
gctcttttgatagggagcaagcagtttgggctttcgaaaaacagtcacattgcgattgcc
ttcgatgacaccaaagttaaaaaccgcctcacaatcgagtttgaagtgcgcacggaagct
gaatcaggcctgcttttttacatggctcggatcaatcatgctgattttgctaccgttcag
ttgagaaatggattgccctacttcagttatgacttgggaagtggtgacaccaacaccatg
atccccaccaagatcaacgatggtcagtggcacaagattaggattatgcgaattaagcaa
gaaggaattatttatgtagatgatgcttccaacagaaccatcagtcccaagaaagctgat
atcctagatgttgtggggatgctgtatgttggcggactgcccatcaactataccacccga
agaattggtccagtgacctacagcattgatggctgcatcaggaattttcagatggcggag
gcccctgtagatcttgaacaaccaacctccagtttccacgttggaacgtgttttgctaat
gctcagaaaggaacatattttgatggaacaggttttgccaaagcagttgatgggttcaaa
gtgggattggaccttcttgtagaatttgaattccgcacaactagaaccactggagttctt
ctaggaatcagcagccagaaaatggatggaatgggtgtcgaaatgattgatgaaaagctt
atgtttcatgtggacaatggtgccggccgattcaccgctgtctatgatgctgggatccct
gggcatttgtgtgatggacaatggcataaagtcacagccaacaagatcaaacaccgcatt
gagctgacggtagatgggaaccaggtgttagcccagagccccaaccaggcatccacatca
gctgatacaaatgaccccgtgtttgttggaggattcccagatggcctcaatcagtttggc
ctgacaaccaacattaggttccgaggttgcatccgatctctgaggctcacgaaaggcaca
ggcaagccgctggaggtcaattttgccaaggccctggaactatggggcgttcaacctgta
tcatgcccagccaactaa

KEGG   Felis catus (domestic cat): 101098499
Entry
101098499         CDS       T02385                                 
Symbol
LAMC3
Name
(RefSeq) LOW QUALITY PROTEIN: laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101098499 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101098499 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098499 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101098499 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101098499 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101098499 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101098499 (LAMC3)
   05145 Toxoplasmosis
    101098499 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B Collagen_mid
Other DBs
NCBI-GeneID: 101098499
NCBI-ProteinID: XP_023098628
Ensembl: ENSFCAG00000005118
LinkDB
Position
D4:91101620..91158660
AA seq 1590 aa
MAAAAVLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRRAEASHTCGRPPED
FCPHVGAPGAGAQCQRCDADDPQLHHDASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRTHAGSPWEPYQYYSASCQRTYGRPEGHYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCQCHGHASECGPEEAGRLACRCQHNTTGVD
CERCLPFFQDRPWARGTAEAANECVPCNCSGHSEECVFDRDLFRGTGHGGRCLRCRDHTA
GPHCERCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDDSGTCACKATVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLGTCDPHSGRCPCKENVEGKQCDRCRPGTFNLQPHNPAGCSSC
FCFGHSKVCSAAAQFREHHILSDLHQGAEGWRAGSVGGPEHPAQWSPRGLLLNPEGEEEL
TLPEKFLGDQRFSYGQPITLTFWVPRGGSPLPVRLRLEGAGLALTLRPSSLSGPQDAGQP
GEAQLTFQLQETSEDAAPPLPPFHFQQLLANLTALRIRAGGQSASPSETSEGQRSRTLAE
GRGTGQVFLTEVRLTSAQRGLSPPASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYT
SCVPCTCNQHGTCDPHTGICLCGHHTEGPSCERCLPGFYGSPFGGRADDCQPCPCPGQSA
CTAIPESREVVCTHCPPGQRGRRCEICDDGXFGDPLGLSGAPQPCRRCQCSGNVDPNAVG
NCDPQSGRCLRCLHNTTGAHCERCEEGFYGSALAPRPADKCTPCSCYPGGSVSEQRPCDP
ASGQCTCLPHVTGRDCSQCSPGFYDLRPGRGCRSCKCHPLGSQEDRCHPKTGQCPCRPGV
EGQACNRCQLGFFGFSIKGCRACRCSPVGAASAQCHENGTCLCRPGFVGYKCEHCQENFF
ITAGGTHCQECPSCYALVKEEASKLKARLTLMEGWLQGSDCSEPWGPLHALQGEAPRGDV
YQGRLLQGAREAFLEQVTGLEGAVKAAREQLRTLSRSVHCARAGTEKTCIQLADLDAVLE
SSEEEILQAALVLRSLVIPQEGSSQPTTWSHLATEARALARSHRDTTAKIEATARRALVA
SNTSYALLWSLVEGRVALEAQQELEDRYQEVQAAQKALGTAAAEVLPEAGRALAAAQQAD
ADAALRPASLAAPAALKSEAGALGLKAQALEKTVASREHVVTEAAGVLQATAQAMLRKTE
PLTQLRQQARAALTRASSSVQAATVTVTGARTLLADLEGMKQQFPSPKDRATLGRKAGVV
RGRLLPDLKKKTKQAERMLGNAASVSSSAKKKGREAKTLAEDSAKLARALLRDGKQEHRR
AGRLSSQAQATLRQASRQVLASQTRRQELEEAEQVGAGLRAVERQIWESRTSLEEDVQAL
LELLARLGSLDTHQAPARALNETQWALERLRLRLSPPGALQGKLRLLEQESKQQELQIQS
FENDLAEIRADKRNLEAILQSLPKSCASWR
NT seq 4773 nt   +upstreamnt  +downstreamnt
atggcggctgcggcggtcctgctgggcctggcgctcctggcgccgcgggcggccggcgcg
ggcatgggcgcgtgttacgacggcgcggggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgttcggccggcgcgccgaggcctcgcacacgtgcggccgcccgcccgaggac
ttctgcccccacgtgggcgcgccgggcgcgggggcgcagtgccagcgctgcgacgccgac
gacccccagcttcaccacgacgcctcctacctcaccgacttccacagccaggacgacagc
acctggtggcagagcccgtccatggccttcggcgtacagtaccccacctcggtcaacatc
accctccgtctggggaaagcctacgagatcacctacgtgaggctgaagttccacaccagt
cgccccgagagctttgccatctacaagcgcacccacgcgggcagcccgtgggaaccctac
cagtactacagtgcctcctgccaaagaacctacggcaggcccgagggccactacctgcgc
cccggtgaggacgagcgcgtggccttctgcacctccgagttcagcgacatctccccgctg
agcgggggcaacgtggccttctccaccctggagggccggcccagtgcttacaacttcgag
gagagccccgtgttgcaggagtgggtcaccagcaccgagctgctcatctccctggaccgg
ctcaacacgttcggggatgacatcttcaaggaccccaaggtgttgcagtcctactactat
gccgtgtctgacttctccgtgggcggcaggtgccagtgccacggacatgccagcgagtgc
gggcccgaggaggcgggccggctggcctgcagatgccagcacaacaccaccggcgtcgac
tgcgagcgctgtctgcccttcttccaggaccgcccgtgggcccggggcaccgctgaggcc
gccaacgagtgtgtgccttgcaattgcagcggccactctgaggagtgtgtgttcgaccgg
gacctcttccgcggtacgggccacggcggccgctgcctgcgctgccgggaccacacggcc
gggccacactgcgagcgctgccaggaggacttctatcgctggagcccccggacgccgtgc
cagccctgtgactgccacccggcaggttcgctacgtctccagtgcgatgactcaggcacc
tgtgcctgcaaggccaccgtcacaggctggaagtgtgaccgctgcctgcccgggttccac
tcactcagtgagggaggctgccgaccctgcacctgcaatcctgctggcagcctgggcacc
tgtgacccgcacagtggacgctgcccctgcaaggagaacgtggaaggcaagcagtgtgac
agatgccgtccagggacgttcaacctgcagccccataacccagccggctgcagcagctgt
ttctgctttggccactccaaggtgtgctcggccgctgcccagtttcgggagcaccacatc
ctctccgacctccaccagggagccgagggctggcgggccggaagtgtggggggcccagag
catcccgcgcagtggagcccaagggggctgctcctgaatccagaaggcgaggaggagctc
acactaccagagaaattcctgggagaccagcggttcagctacggacagcccatcacactg
accttctgggtcccccgcgggggctccccactccccgtgcggctgaggctggaaggggcg
ggcctggccctgactctacgaccctccagcctgtcgggcccccaggatgctgggcagccg
ggggaggcccagctcacgttccagttgcaggagacctctgaggacgcggcccctccgctg
ccccccttccacttccagcagctgctcgccaatctgacggctctgcgcatccgggccggc
ggccagagcgcaagcccttccgagacgtctgaaggtcagagaagtaggacactggctgaa
ggtcgtggaactggccaggtgttcctgactgaggtccggctcacgtcagcccagcggggg
ctctccccaccagcctcctgggtagagacttgctcatgtcccaaagggtacacaggccag
ttctgtgaatcctgcgctccaggatacaagagggagacaccactggggggtccctatacc
agctgtgtcccctgcacctgcaaccagcatggcacctgtgacccccacacagggatctgc
ctgtgtggtcaccacaccgagggcccgtcctgtgagcgctgtttgccaggtttctatggc
agccccttcggaggccgagccgatgactgtcagccttgtccgtgccctggacagtcggcc
tgcacagccatcccagagagcagggaggtagtgtgcacccactgccccccgggccagaga
gggcgtcgctgtgagatctgtgatgacggcntatttggggaccctctggggctctctggg
gccccccagccctgccggcggtgccagtgcagtgggaacgtagaccccaacgccgtgggc
aactgtgacccccagtctggccgctgcctgcgttgcctgcacaacacgacaggtgcccac
tgtgagcgctgcgaggaaggcttctacgggagcgccctggcccctcggcccgcagacaaa
tgcacgccctgcagctgctacccggggggctcagtcagtgagcagagaccctgcgacccg
gcgagcggccagtgcacctgcctgcctcatgtgacgggacgggactgtagccagtgcagc
cccggtttctatgacctccggcccgggaggggctgccggagctgcaagtgtcacccgctg
ggctcccaggaggaccggtgtcaccccaagaccgggcagtgcccctgtcgtccaggcgtt
gagggccaggcctgcaacagatgccagctgggtttcttcggcttctccatcaagggatgc
cgagcctgcaggtgctccccggtgggggccgcctcggcacaatgccacgagaacggcacg
tgcttgtgcagacccggcttcgtggggtacaagtgtgaacactgtcaggaaaacttcttc
atcacggccggtggcacacactgtcaggagtgcccgtcctgctacgccctggtgaaggag
gaggcttccaagctgaaggccaggctgaccctgatggaggggtggctgcaggggtccgac
tgtagtgagccctggggaccactacacgctctgcagggagaggccccacggggagacgtc
taccagggacgtctgctgcaaggagcccgggaagccttcctggagcaggtgacaggcctc
gaaggtgctgtgaaggctgcccgggagcagctgcgtacgctgagcaggagtgtccactgt
gcccgggccggaacagagaagacctgcatccagctggcggacctagatgcagtgctggag
tcttcagaggaggagattctgcaggcggcccttgtcctcagatctctggtgattcctcag
gaagggtccagccagcccaccacctggagccacctggccaccgaggcccgtgcccttgcc
aggagccacagggacaccactgccaagattgaggccactgcgcggagggccctggtcgcc
tccaacaccagttatgcgcttctctggagtctggtggagggcagagtggccctggaggcc
cagcaggaactggaggacaggtaccaggaggtccaggccgcccagaaggcgctgggcacg
gctgcggcagaggtgctgcccgaagctgggagggcgctggccgccgcgcaacaagctgat
gcggatgcagccctgcgcccggcctcgctggccgcccctgcagcactgaagtccgaggcc
ggggccctgggtctgaaggcacaggccctggagaagacagttgcatctagagagcatgtg
gtcaccgaggctgccggggtcctccaggccaccgcccaggccatgctgcggaagaccgag
cccctcacacagctacgccagcaggccagagccgccctgacccgggcttcctcatccgtc
caggctgccacggtgactgtcacgggagccaggaccctgctggccgacctggagggaatg
aagcagcagtttccttcgcccaaggaccgggccacgctggggaggaaggcaggcgtggtc
aggggcaggctccttccagacttgaaaaagaagaccaagcaggcggagaggatgctggga
aatgcggcgtctgtctcctccagtgccaagaagaagggccgtgaagccaagacgttggct
gaggacagtgctaagctcgccagggccttgctgagggacgggaagcaggagcatcgccgg
gcaggccggctgtccagccaggcgcaggcgacgctccgacaggcctcgcggcaggtgcta
gcctcacaaacccgccgacaggagctggaggaagctgagcaggtgggtgccgggctgcgt
gccgtggagcggcagatctgggaatcgcgcacgtccctggaagaggacgtccaggccttg
ttggagctacttgccaggctggggtcactggacacccaccaagccccagcccgggccctg
aacgagacccagtgggcactggagcgcctgaggctgcggctgagcccgccgggggccctg
caggggaaactgaggctgttggagcaggagtccaagcagcaggagctgcagatccagagc
ttcgagaacgacctcgcggagatccgtgccgacaagcggaacctggaggccattctgcag
agcctgcccaagagctgtgccagctggcggtga

KEGG   Felis catus (domestic cat): 101100161
Entry
101100161         CDS       T02385                                 
Symbol
LAMA3
Name
(RefSeq) laminin subunit alpha-3 isoform X5
  KO
K06240  laminin, alpha 3/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101100161 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101100161 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100161 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100161 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101100161 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101100161 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101100161 (LAMA3)
   05145 Toxoplasmosis
    101100161 (LAMA3)
SSDB
Motif
Pfam: Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_G_3 Laminin_EGF DUF745 WXG100
Other DBs
NCBI-GeneID: 101100161
NCBI-ProteinID: XP_019670640
Ensembl: ENSFCAG00000009601
UniProt: A0A2I2UKX1
LinkDB
Position
D3:48384409..48658528
AA seq 1726 aa
MSPTVRWSAWSAGWLWIFGAAVGQCLGYNSQQQRVAFLQPPGQSHLQASYVEFKPSQGCS
PGYYRDSKGAYTGRCVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCKEGHYGNAIHG
HCSVCPCPHSNSFATGCVVTGENVRCSCKPGYTGTQCERCAPGYFGNPQKLGGSCRPCSC
NNNGQLGSCHPLTGDCIDQEPKDGSPGEECDDCDSCVMTLLNDLATMGDELHLVKSQLQG
LSASTGTLEQMKHLETQTKDLRNQLLNYRSAISNHGLKMDGLEKELSNLNREFEALQEKV
QINSRKAQTLHNNVDRTTQSTKELDTKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSRE
LAEAERMMTELRSRNFGKHLREAEAEKRDAQLLLNRIRSWLENHQVENSALVKNIRDSLN
EYEAKLSDLRAALQEATAQAKQATGLNRENEKTLESIKRQVKEMNSLQSDFTKYLTTADS
SLLQTNTLLQLMGKSREEYEKLAATLNEARRELSDKVRELSQSASKASLVVEAETHAQSL
QKLAKQLEEIKRNASGDELVRCAVDAATAYENILNAIRAAEDAADKATSASESALQTVIK
EDLPRKAKTLSSDSDKLLKEAKLTQKKLRQEISPALNNLQQTLKVMTVQKGLIDTNITAI
RDDLRGIQRDDISDMISRAKSMVRNANDITDEVLDGLNPIETDVARIKDTYGSTQREDFN
KALTDADNSVKKLTNKLPDILSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAV
PMRFNGKSGVEVRLPDDLDDLKGYTSLSLFLQRPESKENGGTENMFVMYLGNKDASRDYI
GMAVVDGKLTCVYNLGEQESELQVDQSLTESETQEAVMDRVKFQRIYQFASLNYTKKATS
SKPETPQFHDMESGNSNTLLNLDPENVVFYVGGYPSDFRLPARLRFPPYKGCIELDDLNE
NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPNAPFPTFGQTIQTT
VDRGLLFFAENQDRFISLNIEDGNLLVRYKLNSEPPKEKGVTHTVNNGKDHSIQIKIGKA
QKLMWINVNSKKIRIEGEIFDFGTYYLGGIPISIRERFNISTPAFRGCMKNLKKTTGVVR
LNDTVGVTKKCSEDWKLVRSASFSRDGQLSFTNLDLAFPNHFQASFGFQTFQPSGLLLSH
QTEANNLQVTLEDGHIELNTRDGSSPIFKSPQTYTDGLLHYVSVINDDSGLRLLIDDQPL
KNNHRLRHLSNSQQTLRLGGSHFEGCISNVFIQRLSERPAVLDLASKPTKRGVSLGGCSL
NKPPFLMLLRGSTRFDKAHTFSINQPLRDTPAASPRSMEVWREAQSCRPPPRAQASHGAL
RFGDRPTSHLLFTIPQELLEPRSLFAVDVRTASSRGLVFYTGTKSSYMALYLSKGRLIFA
LGAEGKKLRLKSKEKCNDGKWHTVVFGQDGEKGHLVVDGLRAQEGSLPGNSTFGLRAPVY
LGSPPSWKPKSLPPNSFVGCLRNFQLNLKPLNTIAASVAVSPCLSGSVEKGIYFSQEGGH
IILANSVLLGPEFKLVFSIRPRSLTGILMHVGSQPGKHLCVYMEAGKVTASVDSEAGGIL
TSVTPKQSLCDGRWHSVTVTIKQHILHLELDTENSYTAGRIPFPPASTQEPLYIGGIPAH
LKTLKLPVWKSFFGCLKNIQVNHIPIPVTEAMDVQGSVSLNGCPDH
NT seq 5181 nt   +upstreamnt  +downstreamnt
atgtcccccacagtgaggtggtcagcctggagcgctggatggctgtggatctttggggca
gctgtggggcagtgtctgggatataattcacagcagcaaagggtagcgtttcttcagcct
ccgggtcaaagccatctgcaagcaagttatgtggagtttaagcccagccagggttgtagt
cccggatactatcgggatagcaaaggtgcatataccggacgatgtgttccctgcaattgc
aacggacattcaaatcgatgccaggatggctcgggaatatgtatcaactgccagcataac
actgctggagaacactgtgagcgctgcaaagagggtcactatgggaatgccatccacgga
cactgtagcgtctgcccatgtcctcattccaacagttttgccactggctgtgttgtgact
ggggaaaacgtgaggtgctcctgcaaacctggatacacaggcacacagtgcgaaaggtgt
gcacccggatatttcgggaacccccagaagcttggaggtagctgccggccgtgcagttgt
aacaacaatggccagttgggcagttgtcaccccttgacgggagactgcatagaccaagag
cccaaagatggcagccctggagaagaatgtgatgattgtgacagctgtgtgatgacgctc
ttgaatgacctggccaccatgggtgacgagctccacctggtcaagtctcagctgcagggc
ctgagtgccagcaccggcactttggaacagatgaagcacttggagacccagaccaaggac
ctgaggaatcagttactcaactaccgttctgccatttcaaatcatggattaaaaatggat
ggtctggaaaaagaactgagtaatctgaatcgagagttcgaagctttgcaagaaaaggtt
caaataaattctagaaaagcacagacattacataacaatgttgatcggacaacccaaagc
acaaaggagctggacacaaagattaaaaatgtcatccggaatgtgcacattctcttgaag
cagatctctgggacagatggggaaggaaacaatgtgccgtcaggggatttttccagagag
ttggctgaagcagagcgcatgatgacagagctacggagccgcaactttggaaagcacctg
agagaagcagaagctgaaaaaagagacgctcagctcctgctgaatcggataaggagctgg
ctggaaaaccaccaagtggagaacagtgcacttgtcaagaacatacgggattctttaaat
gagtacgaggccaaactcagtgatctgcgggccgcactacaagaggcaactgcccaggca
aagcaggccactggcctcaaccgagaaaacgagaagactttggaatccatcaagagacaa
gttaaagaaatgaattccctacagagtgatttcaccaagtacctaaccacggcagactct
tccttactgcagaccaacacgctgctgcagctgatggggaaaagccgggaggaatatgaa
aaactagctgccactttaaatgaagcaagacgtgagctaagtgacaaagtgagagaactt
tctcagtccgccagtaaagcctccctggtggtggaggcagaaacgcacgcgcagtcttta
cagaagctggcaaagcagctggaggagatcaagaggaacgccagtggggatgagctggtg
cgctgtgcagtggatgctgccaccgcctacgagaatatcctcaacgccatcagagcagcg
gaggacgcggctgacaaggccactagcgcatctgagtctgccctccagactgtgataaag
gaagatcttccaagaaaagcaaaaaccctgagttctgacagtgataaactattaaaggaa
gccaagctaacacagaagaagctacggcaagaaatcagtccggctctcaacaacctacag
caaactctgaaagttatgacagttcagaaaggattgattgataccaatatcactgccatc
cgagatgaccttcgtgggatacagagagatgacatcagtgatatgatcagtagggcaaag
agcatggtcagaaatgccaacgacatcacagatgaggttctagatgggctcaaccctatt
gagacagatgtggcaagaattaaggatacctatgggagcacacagagagaagacttcaac
aaggctctcactgacgcagataactcagtgaagaaattaaccaacaaactgcctgacatt
ttgagcaagattgaaagtatcaaccaacagctgttgccactgggcaatatctctgacaac
gtggaccgtatccgggagctaattcagcaggccagagatgctgcaaataaggttgctgtc
cccatgaggttcaatggtaaatctggagttgaagtccggctgccagatgacctagatgat
ttgaaaggatacacatctctttctttgtttctccaaagacctgagtcaaaagaaaatggg
gggactgagaatatgtttgtgatgtacctcggaaataaagatgcctccagggactatatc
ggcatggcagttgtagatggcaagctcacgtgtgtctacaacctgggagaacaggagtct
gaactccaagtggaccagagcttgaccgagagcgaaactcaggaggcggttatggaccgg
gtgaaatttcagagaatttatcagtttgcaagcctaaattacaccaaaaaagccacatcc
agtaaacctgaaacaccccaattccatgacatggagagtggaaacagcaacaccctcctc
aacctggaccctgaaaatgttgtattttatgttggaggttacccatctgactttagactt
cccgccagactaaggttccctccgtacaaaggttgtattgaactggatgacctcaatgaa
aatgttctgagcttgtacaacttcaaaaaaactttcaatctcaacacaactgaagtagag
ccttgtagaaggagaaaggaagagtcagacaaaaattattttgaaggtacaggctatgct
cgagttccaactcaaccaaatgctcccttcccgacctttggacaaacgattcaaaccacc
gtggatagaggtttgctgttctttgcagaaaatcaggatcgcttcatatctctaaatata
gaagatggcaatctcctggtgcgctacaaactgaattcagagccaccaaaagaaaaagga
gttacccacactgtcaacaacggaaaagaccattcgatccagatcaaaatcgggaaagcc
caaaaactcatgtggataaatgtgaattctaaaaaaatcagaattgaaggtgaaatattc
gatttcggcacatactatctgggagggattccaatttcaatcagggaaaggtttaacatt
tctacacctgctttccgaggctgcatgaaaaatctgaagaaaactactggtgttgttagg
ttgaatgacactgtgggagtaacaaaaaagtgctcagaagactggaagctcgtgcgatct
gcctcattctccagggatggacagttgagtttcaccaatttggatttggcttttcccaac
cacttccaggcctcctttggatttcagacctttcaacccagtggcctattattaagtcac
cagacagaggcaaataacctgcaggtcaccctggaagatggtcacattgaactgaacacc
agggatggaagtagccccatttttaaatccccccagacgtacacggatggtttgctgcat
tacgtatctgtaataaatgatgactctggactccggcttctcattgatgaccagcctctg
aagaataaccacaggctaagacacttgtcaaattcccagcaaaccctgcgtctgggcgga
agtcactttgagggttgtatcagcaatgtttttatccagaggctctcagagagacctgca
gtcctggacttggccagtaaacctaccaagagaggtgtgtccctgggaggctgcagttta
aataaaccacctttcctcatgttgcttagaggttctacaaggtttgacaaagcccacact
ttcagtatcaaccagccattgcgggacacaccagcggcctccccaaggagcatggaggtg
tggcgagaggcccagtcttgccggccacctccccgggcccaggccagtcacggagccctc
aggtttggggaccgccccaccagccacttgctcttcacgattccccaggagttgctggaa
cccaggtcactgtttgctgtggatgtgcggacagcctcctccagagggctcgtgttttac
acgggcactaagagttcctatatggctctttatctttcaaagggacgactcatctttgct
ttgggggcagaagggaaaaagctgaggctcaaaagcaaagagaagtgcaatgatgggaaa
tggcacacggtggtgtttgggcaagatggagaaaaggggcacttggttgtggatggtctg
agggcccaggaaggaagtttgcctggaaattccacctttggcctcagagcaccagtttac
ctgggatcacctccctcatggaaaccaaagagcctccccccaaacagctttgtggggtgc
ctgaggaactttcagttgaatctgaaacccctgaacaccattgctgcaagtgttgctgtg
tccccctgcttgagtggctctgtggagaaaggcatttatttctcccaagaaggaggtcat
atcatcctggctaactctgtgttattggggccggaatttaagcttgtcttcagcattcgc
ccaagaagcctcactggcatcctaatgcacgtcggaagtcagcccgggaagcacctatgt
gtttatatggaggcaggaaaggtcacggcctctgtggacagtgaggcggggggcatcttg
acatcagttacaccaaagcagtctctgtgtgacgggcggtggcactcggtgacagtcacc
ataaaacaacacatcttgcacctggaactggacacagagaatagctacacagctggacgg
atccccttcccacctgccagcactcaggagccactgtacattggaggcattccagcccat
ttgaagacgctgaagctccctgtgtggaaatcattttttggctgtctgaagaatattcaa
gtcaaccacattcctatccctgtcactgaagccatggacgtccagggatctgtcagtctg
aatggctgtcctgatcactaa

KEGG   Felis catus (domestic cat): 101101552
Entry
101101552         CDS       T02385                                 
Symbol
LAMB4
Name
(RefSeq) laminin subunit beta-4 isoform X1
  KO
K06245  laminin, beta 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101101552 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101101552 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101552 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101552 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101101552 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101101552 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101101552 (LAMB4)
   05145 Toxoplasmosis
    101101552 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N
Other DBs
NCBI-GeneID: 101101552
NCBI-ProteinID: XP_023106010
Ensembl: ENSFCAG00000004479
LinkDB
Position
A2:78403021..78514494
AA seq 1791 aa
MQLPLTFLLHLGLLSFTKAQDKCHRSACHPTTGDLLVGRSAQLTASSTCGLDGAQKYCIL
SYLEGEQKCFICDSRFPYDPYTQSQSHTIENVITSFEPGRDKKWWQAENGLDHVSIRLDL
EALFQFSHLILTFKTFRPAAMLVERSTDYGHTWKVLKYFAKDCAASFPNITSGQAQGVGD
LVCDSKYSDIEPSSGGEVVLKVLDPRFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDTL
LGRRENGSLDNYYYALSNMVVGGSCFCHGHASECGPVQKVRGDVFSPPGMVHGQCVCQHH
TDGPNCERCKGFFQDVPWRPAAGLQDSACRACRCNGHSDRCHFDMTAYLASGGRSGGVCE
DCQHHTEGQHCDRCRPLFYRDPLRAMSDPYACIPCECDPDGTLSGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHHGLSAADPLGCQPCNCNPLGSLPLSACDVETGQCACQSF
ATGPHCEECTVGYWGLENHLHGCSPCDCDIGGAYSNVCSPKDGQCECRPHITGRSCTESA
PGYFFAPLNFYLYEAEEATPLQGLAPLIAATALPTCDVYFQQQGSDFIVDKGTIILKRNQ
KQRVRADEQSEGSVTFGQVPAVHGVFREPVPGSPTAWTGPGFARVLPGAGLRFAVDHIAL
PMDFTIAIRYEIQPAADWAVQILVNPLGKSKHCPRETPWPRPQSFPLPATSRIVLLPTPI
CLEPDVQYSIDVYFSQALEGGAHAHSHILVDSLSLIPQINSLENFCSKQDLDEYHLHNCV
DIALKAGPQMLPGACERLIVSMSARLNNGAVACKCHPQGSVGPNCSRLGGQCQCKPHVAG
RCCDRCSTGSYGLGHHGCHPCHCHPQGSKSAVCDQITGQCACQGEVAGLRCDRCLASYFG
FPNCRPCLCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYGDPPSGRSCRPCPCPDV
PSSNQYFAHSCYQDPWSSDVICNCLQGYAGKQCGECSAGFYGNPRISGAPCRPCACNNNI
DVTDPESCSRVTGECLRCLHDTQGPNCQFCKPGHFGSAINQTCRRCSCHPSGVTPAACPP
GQGACLCDPNTGACPCLPNVTGQTCDRCADRYWNLVPGRGCQPCNCDPRTSHSGHCDQLT
GQCPCKLGYDGQHCSECKENYYGDPLGRCLPCDCNTEGTQKPVCDQNTGMCRCREGVSGP
RCDRCARGHGQEFPACLPCHRCFDQWDRAAASLSKAVQGLIGLAANTEDKTETLLVCEAD
FKGLRENMSEIERILKHPVFSSGEFLKAKDYQDSVREQIMQLSLQLKAVHEFQDLKETMV
RMKSEADLLFEDLRKEIDLRSRAHTANIMDPSETIKKHYQRSSSAEKKITETTSIIKNSE
KTRNDLHSMFDTLSSKENLSLEKLKQITVPDMQILIEKVCGVPGDMPCVLPSCGDPSCRG
SRTLSGHALQQAQEAETVIHNLSDQVQGWKNQLKNVSKLAEVSKSNALQLSEKLRNMKNQ
SESEEEKMSLLIKRLKKFLSEENVPPEDIEKVANRVLDIHLPMASQNLTRELDKIRKLTQ
LCEDNGTDAGRLNKAADEARKVLAKAKGAEKAANVLLNLDKTLNRLQQVQTTQGRINSAI
TQLTAEITKIKKNTVQAEKEAKDTENKLDSAKQQSVLEAGLSQLRTTLQRNRGRAARLRA
QAASAQRQAGGLEQEFAELNNQYAVLQHKTSATGLTKVTLDKVEQLKEAAEKLATDTEDK
IRRIADLEKKTQDLNLSRQEKADQLKELEDQVVALKNEIVERENKYAACYR
NT seq 5376 nt   +upstreamnt  +downstreamnt
atgcaattgccactgacctttcttttacaccttgggttgctcagtttcacgaaagcccaa
gataaatgccacaggagcgcctgtcatcctaccactggtgatctcctggtgggtcgcagc
gcacagctcacggcttcttctacctgtgggctggatggagcccagaaatactgcatcctc
agctaccttgagggggaacaaaaatgtttcatctgtgactccagatttccctatgacccg
tatacgcaatcccagagccacaccattgagaatgtcattacaagttttgaaccagggaga
gacaagaaatggtggcaagctgaaaacggtcttgatcatgtcagcatcagattggaccta
gaggcgttatttcagttcagccaccttattctgacttttaagacttttcggcctgctgct
atgttagtcgaacgttccacagactatggacacacctggaaagtgctcaaatattttgca
aaagactgtgctgcttcctttcccaatatcacttctggccaggcccagggagtgggagac
cttgtctgtgactccaaatattcggatattgaaccctcatctggtggagaggtcgtttta
aaggttttggatcccaggtttgaaatagaaaacccctacagcccctacatccaggacctt
gtgacattaacaaacctgaggatcaacttcaccaaactccacaccctgggggacaccttg
cttggaaggagggaaaacggttctctggataactactactacgctctgtccaacatggtg
gtggggggcagctgtttttgccacggccacgctagcgaatgtggccccgtgcagaaagtg
cggggagacgttttcagccctcctggaatggttcacggccagtgtgtctgtcagcaccat
acagatggcccgaactgtgagaggtgcaagggcttcttccaggacgttccgtggaggccg
gcagcaggcctccaggacagcgcatgcagagcttgtcgctgcaacggccactcggaccgc
tgtcacttcgacatgaccgcgtacctggcgagcggcggccgcagcgggggcgtgtgcgag
gactgccagcaccacacggagggacagcactgtgaccgctgcagacccctcttctacagg
gacccgctcagggccatgtccgatccttacgcgtgcatcccttgtgaatgtgacccggac
gggaccttatcgggtggcatttgtgtgagccactctgatcctgctttggggtctgtggcc
ggccagtgcttgtgcaaggagaacgtggaaggagccaagtgtgaccagtgcaagcccaac
caccacggactgagcgccgctgaccccctgggctgtcagccctgcaactgtaaccccctc
gggagtctgcctctctcagcctgtgatgtggagactggccaatgtgcatgccagtcattt
gccaccggaccacactgtgaagagtgcactgttggatactggggactggaaaatcacctc
catggatgttctccctgtgattgtgacattggaggtgcttattccaacgtgtgctccccc
aaggatggccagtgtgaatgccgcccgcacatcactggccgcagctgcactgaatcagcc
cccggctacttctttgctcctttgaatttctatctctacgaggcagaggaagccacccct
ctccaaggacttgcacctttgatagcagcaacagctttgcctacgtgtgatgtgtacttc
cagcaacaagggagtgatttcatagttgacaaaggcacgataatactgaagagaaatcag
aagcagagggtacgtgctgacgagcagagcgagggctcagtgacttttggccaggtgcct
gctgttcatggtgttttccgagaaccggttcctggaagccctactgcgtggactggacct
ggatttgcccgggttctccctggggctggcttgagatttgcagtcgaccacattgccctt
cccatggacttcaccatcgccattcgctatgagattcagcccgcagccgactgggctgtc
cagatcctggttaaccccctcggaaagagcaagcactgtccacgtgagaccccatggcca
cgacctcagtccttccctttaccggcgacttccagaatcgtgctgcttcccacgcccatc
tgtttagaaccagatgtacaatattccatcgacgtctatttttcccaggctttggaaggt
ggggcccacgctcattcacacatcctggttgattcacttagtctgattccccagatcaat
tcactggagaatttctgcagcaagcaggatttggatgaatatcacctgcacaactgtgtt
gacattgccttgaaagcaggacctcagatgctcccgggtgcgtgtgaaaggctcatagtg
agcatgtctgccaggctaaacaatggggcagtagcctgcaagtgtcacccccagggctcg
gtggggcccaactgcagccggcttgggggccagtgccagtgtaagccccacgtggccggg
cgctgctgtgacaggtgctccacaggaagctacggtttaggacatcatggctgtcaccca
tgtcactgccaccctcaaggctcaaaaagcgctgtatgtgaccaaataacgggacagtgc
gcctgccagggggaggtggctggcctccgttgtgatcggtgcctggcaagctactttgga
tttcccaactgccgcccttgcctttgtaatggtttcgctgagctttgtgatccagagaca
gggtcatgcttcaattgcgggggttttacaacaggaagaaactgtgaaaggtgcatcgat
ggttactatggggatcctccttcaggacgctcctgccgtccttgcccgtgtccggatgtt
ccctcgagtaatcagtattttgctcattcctgttatcaggatccttggagctcagatgtg
atctgcaattgtcttcaaggttatgcaggtaagcagtgtggcgaatgctctgcgggtttc
tatggaaatcccagaatttcaggagcaccttgccggccatgtgcctgcaataacaacatc
gatgtgactgatccagagtcctgcagccgggtaacaggggagtgccttagatgtctgcac
gacactcagggacccaactgccagttctgcaaaccgggtcactttggatcggccatcaat
cagacctgcagaaggtgttcctgccatccttccggtgtgactcctgctgcgtgtccgcct
ggtcagggagcttgcctctgtgaccccaacactggcgcatgtccttgtctccccaacgtc
acaggccagacctgtgaccgttgtgctgacagatactggaatctggtccctggcagagga
tgtcagccatgcaactgtgacccccggacctctcacagtggccactgtgaccagcttaca
ggccagtgtccgtgtaaattaggctacgatgggcaacactgcagtgagtgcaaggaaaat
tattatggtgatccactggggcgatgccttccatgtgactgcaacacagaaggtacccag
aagcccgtctgtgaccagaacacaggcatgtgccgctgtcgggagggtgtgagcggccct
cgttgcgatcgctgtgcccggggtcacggccaggaattccctgcctgtcttccgtgtcac
cggtgctttgatcagtgggaccgtgctgctgcttccctctccaaagcagtgcaagggtta
attgggctggctgctaacacggaagataaaacagagaccctgcttgtctgtgaggccgac
ttcaaaggcctcagagagaacatgtctgaaatagaaaggattttaaaacatcctgttttc
tcatctggggaattcttaaaagccaaggattatcaagactctgtacgggaacaaatcatg
cagctaagtctgcaactgaaagcagtacatgaatttcaagatctgaaagaaacaatggta
agaatgaagagcgaggcagacctcttatttgaagatcttcggaaagaaattgatttgcgc
tcccgggcccatactgcaaacatcatggatccctcagagactatcaagaagcattatcag
aggtcatcatctgctgaaaagaaaattactgaaaccacttctatcataaaaaactctgaa
aaaaccaggaatgacttacatagcatgtttgatacgctaagctcaaaagaaaacttgtca
ttggaaaaattaaagcagattacagtcccggatatgcaaatactgattgaaaaggtgtgt
ggggtaccaggggacatgccgtgcgtgcttccgtcctgtggggaccccagctgccgtggc
tcccggaccctctccggccatgccctccagcaagctcaggaagcagagactgtgattcat
aatttgagcgaccaggttcaaggttggaagaatcagctcaaaaatgtaagcaaactggca
gaagtctccaaaagcaatgccttacagctgagtgagaaactgaggaatatgaaaaaccaa
agtgaatctgaagaagaaaaaatgagtcttttaatcaaacgactgaaaaagtttttgtca
gaggaaaatgtgcctccggaggacatagagaaggttgcaaatcgtgtacttgacatccat
ctaccaatggcatcacaaaatctaacccgtgaacttgacaagatacgaaaactgacgcag
ctctgtgaggacaacggcacagatgcgggcaggctaaataaagcggcagacgaagcccga
aaggttttggcgaaagcaaaaggagctgaaaaagcagcaaatgttctattaaatcttgac
aaaacgctgaatagattgcaacaagttcaaaccacccaaggacggataaattctgccatc
acacagctgactgcagagataacaaaaattaaaaagaacaccgtgcaggctgaaaaggaa
gccaaggacaccgagaacaagctggattcagcaaagcagcagtcggtgctggaagctgga
ctctcccagctgcggaccacgttgcaaaggaacagggggcgagcggcccgcctgagagct
caggctgcatcggcccaacgccaagctgggggccttgaacaggagtttgcagagctaaac
aaccaatatgctgttcttcagcataagacaagtgctacaggactgacaaaggtaacatta
gataaagtggaacagctaaaagaggcggcagaaaaactggccacagatacagaagacaag
ataagaagaatagcagatttagaaaagaagacccaagatttgaatctgagtagacaagaa
aaagctgaccagctgaaagagttggaagatcaagtcgttgcccttaaaaatgagattgtt
gagcgagaaaataaatacgctgcttgctacagatag

DBGET integrated database retrieval system