KEGG   Felis catus (domestic cat): 101080369
Entry
101080369         CDS       T02385                                 
Symbol
ELMO1
Name
(RefSeq) engulfment and cell motility protein 1 isoform X1
  KO
K12366  engulfment and cell motility protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101080369 (ELMO1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101080369 (ELMO1)
   05135 Yersinia infection
    101080369 (ELMO1)
   05100 Bacterial invasion of epithelial cells
    101080369 (ELMO1)
SSDB
Motif
Pfam: ELMO_ARM ELMO_CED12 PH_12 FERM_N Imm42
Other DBs
NCBI-GeneID: 101080369
NCBI-ProteinID: XP_019681262
Ensembl: ENSFCAG00000004630
UniProt: M3W2J8
LinkDB
Position
A2:complement(128858242..129588568)
AA seq 742 aa
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSGMDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQ
TYTIAVINALFLKAPDERRQVGVESSVDILDCPLTEMANILAQKQLRSIILTNVIRAQRA
INNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSM
EKRKSMYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSR
EDKHECPFGRSSIELTKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNK
TWKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLDQFKCKLQNLSYTEILKIRQSERMNQ
EDFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNCRRRQDKFWYCRLSPNHKV
LHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSIL
YDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSELTRNDLDTLLSMEIKLRLLDLENIQ
IPDAPPPIPKEPSNYDFVYDCN
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgccgccccccgcggacatcgtcaaggtggccatagaatggccgggcgcctaccccaaa
ctcatggaaatcgatcagaaaaaaccactgtctgcaataataaaggaagtctgtgatggg
tggtcccttgccaaccatgagtactttgcactgcagcacgccgatagttccaacttctat
atcacagaaaagaatcgcaatgaaataaaaaatggcactatccttcgattaaccacatct
cctgctcaaaacgcccagcagctccatgaacgaatccagtcgtcaagtatggatgccaag
ctggaagccctgaaggacttagccagcctctcccgggatgtcacatttgcccaggagttt
ataaatctggatggcatctctctccttacgcagatggtcgaaagcggcaccgaacgatac
cagaaattgcagaagatcatgaagccttgctttggagacatgctgtccttcaccctgaca
gcctttgttgagctgatggaccatggaatagtatcctgggatacgttttcagtggcgttt
attaagaagatagcaagttttgtcaacaaatcgggcatggacatctcaatcctgcaacgg
tccttggccattttggagtcaatggtgctcaatagccatgacctctaccagaaggtggct
caggagatcactattggacaacttatcccacatcttcaagggacagatcaagaaatccaa
acctataccattgcagtgattaatgcacttttcctgaaggctcctgatgagagaaggcag
gttggtgtagagagcagtgttgacatccttgattgtcctctgactgagatggcgaatatt
ttggctcagaagcagcttcgttccatcattttaacaaatgttatccgagctcagagagcc
atcaacaatgaaatggcacaccagctgtatgtgctacaggtgcttacctttaaccttcta
gaagacaggatgatgaccaagatggaccctcaggaccaggctcagagggacatcatattt
gaacttcgaagaattgcttttgatgcagagtctgaacctaataacagcagtggcagcatg
gagaaacgcaagtccatgtacacacgggattataaaaaacttggcttcattaatcatgtc
aaccctgccatggactttacccagacccctcctgggatgttagccctggacaatatgctg
tactttgccaagcaccaccaggatgcctacatccggattgtgcttgagaacagtagccgg
gaggataagcatgaatgtccctttggccgcagcagcatagagctgaccaagatgctgtgt
gagatcttgaaagtgggcgagctgcctagtgagacctgcaacgacttccacccaatgttc
ttcacccatgacagatcctttgaggagtttttctgcatctgtatccagctcctgaacaag
acatggaaggaaatgagggcaacttctgaagacttcaacaaggtaatgcaggtggtgaag
gagcaggttatgagagctctcacaaccaagcctagctccctggatcagttcaagtgcaaa
ctgcagaacctgagctacaccgagatcctgaaaatccgccagtctgagaggatgaaccag
gaagatttccagtctcgcccgattttggaactaaaggagaagattcagccagaaatcttg
gagctgatcaaacagcaacgcctgaaccgccttgtggaagggacctgctttaggaaactc
aactgccgacggaggcaagacaagttttggtactgtcgactttcacccaaccacaaggtt
ctgcattatggagacttggaagaaagtcctcagggagaagtgccccacgattccttgcag
gacaaattgccggtggcagatatcaaagcggtggtgacggggaaggactgccctcatatg
aaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaacttgctttctcgatcttg
tatgactcaaactgccagctgaacttcatagctcctgacaaacacgagtactgtatctgg
acagatgggctgaatgcgctgctggggaaagacatgatgagtgagctgacccggaatgac
ttggacaccctgctcagcatggaaatcaagctccgcctcctcgacctggaaaacattcag
atccccgacgcacctccacccatccccaaggagcccagcaactatgacttcgtctatgac
tgtaactga

KEGG   Felis catus (domestic cat): 101083071
Entry
101083071         CDS       T02385                                 
Symbol
ELMO2
Name
(RefSeq) engulfment and cell motility protein 2 isoform X1
  KO
K18985  engulfment and cell motility protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101083071 (ELMO2)
   05135 Yersinia infection
    101083071 (ELMO2)
   05100 Bacterial invasion of epithelial cells
    101083071 (ELMO2)
SSDB
Motif
Pfam: ELMO_ARM ELMO_CED12 PH_12 SIL1
Other DBs
NCBI-GeneID: 101083071
NCBI-ProteinID: XP_023106934
Ensembl: ENSFCAG00000024946
LinkDB
Position
A3:14883917..14924133
AA seq 732 aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLY
ITEQTRSDIKNGTILQLAVSPSRAARQLMERTQSSNMEARLDAMKELAKLSADVTFATEF
INMDGIVVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDKHLNPLDLPVTDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYV
LQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNVPGSGTEKRKAMYTKD
YKMLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGR
SAIELTKMLCEILQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAE
DFNKVMQVVREQITRALPSKPSSLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVE
LREKIQPEILELIKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNP
QGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFI
APNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIPEAPPPVPK
EPSSYDFVYHYG
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgccaccaccatcagacattgtcaaagtagccattgaatggccaggtgctaatgctcag
ctccttgaaatcgaccagaaacggcctctggcatccatcatcaaggaagtttgtgacggg
tggtccttgccaaacccggagtattacaccctccgttatgcagacggcccccagctctac
atcacggagcagacgcgcagtgatattaagaatgggaccatcttacagctggctgtctcc
ccgtcccgggctgcacgccagctgatggagaggacccagtcgtccaacatggaggcccgg
ctggatgccatgaaggagctggccaagctctctgccgacgtgaccttcgccaccgagttc
atcaacatggacggcatcgtggtgctgacgcggcttgtggagagtggaaccaagctcttg
tcccactacagtgagatgctggcattcaccttgactgccttcttagagctcatggaccat
ggcattgtctcctgggacatggtttccatcaccttcatcaagcagattgcagggtacgtg
agccagcccatggtggacgtgtcaatccttcagaggtccctggccatcctggagagcatg
gtcttgaacagccagagcctgtaccagaagatagcagaggaaatcaccgtgggacagctc
atctctcacctccaggtctccaaccaggagattcagacctacgccattgcactgattaac
gcgcttttcctgaaggctcctgaggacaagcgacaggacaagcaccttaaccctctagac
ctacctgtcactgatatggccaacgcatttgcacagaagcaccttcgctccataatcctg
aatcatgtgatccgagggaaccgcccaatcaaaactgagatggcccatcagctgtatgtc
ctgcaagtcctgacctttaaccttctggaagaaaggatgatgaccaagatggaccccaat
gaccaggctcaaagagacattatatttgaactgaggaggatcgcatttgatgcagagtct
gaccctagcaacgtccccgggagtgggactgaaaaacgcaaagccatgtacaccaaggac
tacaaaatgctggggtttacaaaccacatcaacccagcgatggactttacccagactcct
cctggaatgctggccttggacaacatgctgtacttggctaaagtccatcaggacacctac
atccggatcgtcttggagaacagcagccgagaggacaaacacgagtgccccttcggccgc
agcgccattgagctcaccaagatgctctgtgagatcctgcaggttggggaactgccaaac
gagggccgcaacgactaccacccgatgttctttacccatgaccgggcgtttgaggagctc
tttgggatctgcatccagctgttgaacaagacctggaaggagatgagggcgacagccgag
gacttcaacaaggtcatgcaggtggttcgagagcagatcactcgagctttgccctccaaa
cccagctccttggatcagttcaagagcaaactgcgtagcctgagctactctgagatcctg
cggctgcgccagtccgagcggatgagtcaggacgacttccagtccccgccgatcgtggag
ctgagggagaagatccagcccgagatccttgagctgatcaagcagcagcgcctgaaccgt
ctctgtgagggcagcagcttccggaagattgggaaccgccgaaggcaagaacgtttctgg
tactgccgcttggccctgaaccacaaggtcctgcactatggtgacttggacgacaaccct
caaggggaggtgacatttgagtccctgcaggagaaaattcctgttgcagacattaaggcc
attgtcactgggaaagattgcccacacatgaaagagaagagcgctctgaaacagaacaag
gaggtgttggagttggccttctccatcctgtatgaccccgatgagaccttaaacttcatc
gcgcctaacaagtatgagtactgcatctggatcgatggcctcagtgcccttctggggaag
gacatgtccagtgagctgaccaagagtgacctggacaccttgctgagcatggaaatgaag
ctacggctcctggacctggagaacatccagattcccgaagccccaccaccagtgcccaag
gagcccagcagctatgactttgtctatcactacggctga

DBGET integrated database retrieval system