KEGG   Felis catus (domestic cat): 101080371
Entry
101080371         CDS       T02385                                 
Symbol
BIRC7
Name
(RefSeq) baculoviral IAP repeat-containing protein 7 isoform X1
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04120  Ubiquitin mediated proteolysis
fca04215  Apoptosis - multiple species
fca05145  Toxoplasmosis
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101080371 (BIRC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101080371 (BIRC7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101080371 (BIRC7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101080371 (BIRC7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101080371 (BIRC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101080371 (BIRC7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101080371 (BIRC7)
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I32: IAP family
   101080371 (BIRC7)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101080371 (BIRC7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 zf-RING_5 zf-C3HC4 Prok-RING_4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 101080371
NCBI-ProteinID: XP_019681817
LinkDB
Position
A3:complement(1171885..1176610)
AA seq 422 aa
MGPEDRAKCRCCGPERSCWVAGRSPTRAHCGPLSLCGSIVDQDTSCALSWGGRDHTDGQI
LGQLRPLAEEEEEEEEGARAAPATGPAFPGMGSEELRLASFYDWPLSAVVRPEPLAAAGF
FHTGRQDQVRCFFCRGGLQSWEQGDDPWTEHAKWFPRCGFLLQTKGRDFVCSVQESCYHP
LGSWDQSEEPADSAPTTPSDARGRQEWPAWSRCPAVQAALCMGFGQNQVRRLVQRKYLWA
VPASVSASQLVADLLQEDDGGRAAEARGACPPLPHALPWHTVPTAQGPEGPSWWRGLWGV
RAAWAPPEPDLACGAPWVGSHFPWGLLVCPTPPTAPVHVGPEPPTPRREAQSEGATEPGA
QDAQEQLRRLQEERTCKVCLDHPVCTVLVPCGHLVCSDCAPVLRLCPLCRAPIRSCVRTF
LP
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggggcccgaggacagagccaagtgccggtgctgtggccctgagcgaagctgctgggtg
gccggccgcagtcccacacgggcccactgtggacccctctctctgtgcggctccattgtg
gaccaggacaccagctgtgccctgtcctggggaggccgggaccacacagatgggcagatc
ctgggccagctgcgcccccttgcagaggaggaggaggaggaggaggagggggccagggca
gctccagccacagggccggccttccccgggatgggctctgaggagctgaggctggcctcc
ttctacgactggccgctgagtgctgtggtgcggccagagccgctggctgccgcaggcttc
ttccacactgggcggcaagaccaagtgaggtgcttcttctgccgcgggggtctgcagagc
tgggagcaaggggatgacccctggacagagcatgccaagtggttccccaggtgtgggttc
ctgctccagacaaaaggaagggactttgtctgcagcgtccaggagtcttgttaccacccg
ctgggttcctgggaccaatcggaagaacccgcagactcagcccccaccaccccttcagat
gccaggggcaggcaggagtggcctgcatggagccggtgcccggcagtgcaggctgccctc
tgcatgggcttcgggcagaaccaggtacggcggctggtgcagcgtaagtacctctgggcg
gtgccggccagcgtatccgcgtcccagctggtggccgacctgctccaggaagatgacggg
ggccgggctgcggaggccagaggtgcgtgcccgcccctgccccatgctctcccctggcat
acagttcccactgcccaggggccggagggcccgtcctggtggcgcgggctctggggggtt
cgggcagcatgggctccgccagagccagacctcgcctgtggggccccctgggtggggtct
cacttcccctgggggcttctagtctgtcccacaccacccacagctcctgtccacgtgggt
cctgagccgcccacgcccagaagggaggcccagtcagaaggtgccacagagccaggagcc
caggacgcccaggagcagctgcggcgtctgcaggaggaacggacctgcaaggtctgcctg
gaccaccccgtgtgcaccgtcctcgtgccctgcggccacctggtctgctcggactgcgct
cctgtgctgcggctctgccccctctgcagggcccccatccgcagctgcgtgcgcaccttc
ctaccctag

KEGG   Felis catus (domestic cat): 101083444
Entry
101083444         CDS       T02385                                 
Name
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca04668  TNF signaling pathway
fca05132  Salmonella infection
fca05145  Toxoplasmosis
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101083444
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101083444
   04064 NF-kappa B signaling pathway
    101083444
   04668 TNF signaling pathway
    101083444
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101083444
   04215 Apoptosis - multiple species
    101083444
   04217 Necroptosis
    101083444
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101083444
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101083444
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101083444
   05202 Transcriptional misregulation in cancer
    101083444
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101083444
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101083444
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101083444
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101083444
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101083444
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101083444
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101083444
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I32: IAP family
   101083444
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101083444
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 101083444
NCBI-ProteinID: XP_019666764
Ensembl: ENSFCAG00000014021
UniProt: M3WJY0
LinkDB
Position
D1:1038120..1057786
AA seq 624 aa
MHKATSPEKGWSLCHPVRFVMNIGANSTLSSKLLKGGTVSGLKYDHSCELYRMSTFSAFP
AGAPVSERSLARAGFYYTGRKDRVRCFCCGLTLDNWKQGDSPLEKHRRLYPSCSFIQSLN
PVSASGAPSQPACPSSGTSSRLLPPPSVENGGCPSRSCATFPQNPVTFRANQGLCPRRTS
PHHRAMEAEEARLHSFQGWPLTFPLPEQLARAGFYYLGPGDKVACFACGGRLSNWEPDDD
ALSEHLRHFPFCPFAESRLQDTLRCAVSNRSMQTHAARSRSFCSWPPSVPVLPEQLALAG
FYYMGHSDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIRIKGHEFISQIQASHPC
LLEQLLSTSDNTEDENAESPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRNLVKQTVQ
SKILTSGENYKTVSDIVSDLLNAEDEIREEEKERATEEKESDDVSLIRKNRMALFQRLTS
VLPILDGLRTARVITEQEHSVITQKAQTSLQARLLIDAVLVKGSFAVTVFKNCLLEMDPV
LYERFFVQQDLKYVPTEDVSGLPVEEQLRRLQEERTCKVCLDREVSIVFIPCGHLVVCQD
CAPPLRKCPICRGPIKGTVRTFLS
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgcacaaagctacctccccagagaaaggctggtccctttgccaccccgtccgtttcgtc
atgaacatcggagcaaacagcacattgtcatcaaagctgctgaaaggcggcaccgtgtcg
gggctgaaatacgaccactcgtgtgagctgtaccgaatgtccacgttctcggccttcccc
gccggcgcccccgtctcggagcggagcctggcccgggccgggttctactacacgggccgg
aaggacagggtccggtgcttctgctgtggcctgacgctggacaactggaagcagggggac
agtcccctggagaagcatcggaggctgtaccccagctgcagcttcatccagagtctaaat
ccggtgagcgcttcgggcgccccctctcagcccgcctgtccttcctcagggacgagctcc
aggctcttgccgcctcccagcgtggaaaacgggggctgtcctagccgctcctgcgccacc
ttcccgcagaaccctgtgaccttcagagcaaaccaaggtctctgtccccggaggacgagt
ccccaccaccgtgcgatggaggctgaggaagccagattgcactcgttccagggctggccc
ttgaccttcccgctgccggagcagctggccagagctggattttactacctgggccctggg
gacaaggtggcctgcttcgcctgcggcgggagactgagtaactgggagccggacgacgac
gccctgtcggagcacctgagacacttccccttctgcccgttcgcagaaagccggcttcag
gacaccttgcggtgcgccgtgtccaaccggagcatgcagacgcacgcggcccgctcccga
agcttctgcagctggccccccagcgtgcctgttctccccgagcagctggccctggctggc
ttctactacatggggcacagtgatgacgtcaaatgcttttgctgcgacggtggactgcgc
tgctgggaatcaggagacgacccgtgggtggagcacgccaagtggtttccaaggtgtgag
tatttgatacgaatcaaaggacacgagttcatcagtcagattcaagccagtcacccctgt
ctccttgaacagttgttatctacttcagacaacacagaagatgaaaatgctgagtcacca
attgttcattttgggccgggagaaagttcctccgaagatgccgtcatgatgaacacaccc
gtggtgaaagcggccttggagatgggcttcagtagaaacttggtgaagcagaccgttcag
agcaagatcctgacgagcggggagaattacaaaacagtcagtgatattgtatcagattta
cttaatgcagaagatgaaatcagggaagaggagaaagaaagagccactgaggaaaaagaa
tcagatgatgtgtcattaatccggaagaacagaatggcgctctttcaacgtctgacttcc
gtactccccatcctggatggtctccgaactgccagagtgattactgagcaagaacacagt
gttattacacagaaagcacaaacatctctgcaagcaagattgctgattgatgctgtgtta
gtgaagggaagttttgcagtcaccgtatttaaaaactgtctcctagaaatggaccccgtg
ttatacgagcgcttcttcgtgcaacaggacctaaagtatgttcccacagaagatgtttca
ggtttgccagtggaagagcagctgaggaggctgcaggaggaaagaacctgcaaagtgtgc
ctggaccgagaagtgtccatagtgttcattccctgcggccacctggtggtgtgccaagac
tgtgcccctcccctcagaaaatgccccatttgcaggggcccaatcaagggcaccgtccgg
acctttctgtcgtga

KEGG   Felis catus (domestic cat): 101090594
Entry
101090594         CDS       T02385                                 
Symbol
XIAP
Name
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase XIAP
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca05145  Toxoplasmosis
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101090594 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101090594 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101090594 (XIAP)
   04215 Apoptosis - multiple species
    101090594 (XIAP)
   04217 Necroptosis
    101090594 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090594 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101090594 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090594 (XIAP)
   05207 Chemical carcinogenesis - receptor activation
    101090594 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101090594 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101090594 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101090594 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101090594 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101090594 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101090594 (XIAP)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101090594 (XIAP)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101090594 (XIAP)
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I32: IAP family
   101090594 (XIAP)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101090594 (XIAP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    101090594 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 101090594
NCBI-ProteinID: XP_011277760
Ensembl: ENSFCAG00000012037
LinkDB
Position
X:103741876..103788765
AA seq 496 aa
MTFNSFEASKPCVPADLSKDEDFVEEFNRLKTFTNFPSNSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENHAAQPTNPGIQNGQYKAESY
LGNRNHFVVERPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIEDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SDVSSDRNFPNSTNAPRNPAMADYEARIVTFGTWMYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQDYVTNIHLTHSLEDSMVRTAEKMPS
LTKRIDDAIFQDPMVQQAIRMGFNFRDIKKVMEEKIQTSGSNYKSLEILVTDLVSAQKDN
TQDEPSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKC
PMCYTIITFKQKIFMS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaagcatctaaaccttgtgtacctgcagatctcagtaaggat
gaagactttgtagaagagtttaatagattaaagactttcactaattttccaagtaatagt
cctgtctcggcatcaacgctggcacgagcgggttttctgtataccggcgaaggagacact
gtgcgctgcttcagctgccacgcagcagtagatagatggcaatatggagactcagcggtt
ggacgacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
catgctgcgcaacctacaaaccctggtatccaaaatggtcagtataaagctgaaagctat
ctgggaaacagaaatcattttgttgtagagaggccatctgagactcacgcagactatctt
ttgagaactggacaggtcgtagatatatcagacaccatatacccgaggaaccccgccatg
tatagtgaagaagctagattaaagtcatttcagaactggccagactatgcccacctgacc
ccaagagagttagctagcgctggactctactacacaggtattgaggatcaagtgcagtgc
ttttgttgtggcggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcggcactttcctaattgcttctttgttttgggccggaatgtgaatgttcgaagtgaa
tctgatgtgagttctgataggaatttcccaaactcgacaaatgctccaagaaatccagcc
atggcagattatgaagcacggatcgttacttttgggacgtggatgtactccgttaacaag
gagcagcttgcaagagctggattttatgctttaggggaaggtgataaagtaaaatgcttt
cactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacatgct
aagtggtatccagggtgtaaatatctgttagaagagaagggacaagactatgtaaccaat
attcatttaacccattcacttgaggactctatggtaagaactgctgaaaaaatgccatca
ttaaccaaaagaattgatgatgccatcttccaagatcctatggtacagcaagctatacga
atgggattcaatttcagagacattaagaaagtaatggaagaaaaaattcagacatctggg
agcaactataaatcacttgagattctggttacagacctagtgagtgctcagaaagacaat
acacaggatgaaccaagccagacctcattgcagaaagagattagtgccgaagagcagcta
aggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtggtt
tttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaatgt
cccatgtgctacacaatcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Felis catus (domestic cat): 101101663
Entry
101101663         CDS       T02385                                 
Symbol
BIRC2
Name
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca04668  TNF signaling pathway
fca05132  Salmonella infection
fca05145  Toxoplasmosis
fca05168  Herpes simplex virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101101663 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    101101663 (BIRC2)
   04064 NF-kappa B signaling pathway
    101101663 (BIRC2)
   04668 TNF signaling pathway
    101101663 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101101663 (BIRC2)
   04215 Apoptosis - multiple species
    101101663 (BIRC2)
   04217 Necroptosis
    101101663 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101663 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101101663 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101663 (BIRC2)
   05202 Transcriptional misregulation in cancer
    101101663 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101101663 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101101663 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101101663 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101101663 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101101663 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101101663 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101101663 (BIRC2)
Peptidases and inhibitors [BR:fca01002]
 Peptidase inhibitors
  Family I32: IAP family
   101101663 (BIRC2)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101101663 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039
Other DBs
NCBI-GeneID: 101101663
NCBI-ProteinID: XP_023094808
Ensembl: ENSFCAG00000031094
LinkDB
Position
D1:1070026..1096665
AA seq 619 aa
MHKTTSQRLVPGSSCQRIKSTMEDSTIFTNRTVGSKQRIQYDLSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVKDKVRCFCCGLMLDNWKHGDSPIEKHKQLYPSCSFIHSLVSLT
SLESTSKNASPLRNSFPHLLSPTSEHGGTFSGSHSNLSPNSVNSRALEDFSPLRTNPYSY
AMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDKVACFACGGTLSNWEPKDDALSE
HRRHFPNCPFLENSLETLRFSISNLSMQTHAARLRTFVCWPSSVPVQPEQLASAGFYYVG
RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQDFVDEIQARYPHLLEQL
LSTSDTPGDENTDPPIVHFGPGENSSEDAVMMNTPVVKAALEMGFSRNLVKQTVQSKILT
SGENYKTVSDIVLALLDAEDETREEEKERQTEELASDDLSLIRRNRMALFQQLTCVLPIL
DNLLKANVINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAANIFKSCLKEIDPTLYKNL
FVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCLDREVSIVFIPCGHLVVCQDCAPSL
RKCPICRGIIKGTVRTFLS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcacaaaactacttcccagagactcgtgccaggttcttcttgtcagagaattaagagt
acgatggaagatagcacgatcttcacaaatcggacagtcggcagcaaacaaagaatacag
tatgacctttcatgtgaactgtataggatgtccacgtattcgacgtttcccgccggtgtt
cctgtctcagaaaggagtctcgcgcgtgctgggttttactacactggtgtgaaggacaag
gttagatgcttctgctgtggcctgatgctggacaactggaagcatggagacagtcctatt
gaaaagcataaacagctgtatcccagctgtagttttattcacagtctggtttctcttact
agtctggaatccacctctaagaatgcttctccactgagaaacagttttccacatttgctg
tctcccacttcggaacacggtggcacattcagtggttctcattccaacctttcaccaaac
tctgtgaattctagagcactcgaagacttctccccattgaggactaacccctacagttac
gcgatgagtactgaggaagctcgatttctgacttaccacatgtggccattaaccttcttg
tcaccctcagagttggcgagagccggcttctattacatagggcctggggacaaggtggcc
tgctttgcttgcggtggcactctcagtaactgggagcccaaggatgatgctctgtcagag
catcggagacattttcccaactgcccgtttctggaaaattctctggagacgctgaggttt
agcatttcaaacctgagcatgcagacgcacgcagctcggctgagaacgttcgtgtgctgg
ccgtcgagcgtcccggtccaacccgagcagctcgccagtgccggcttctattacgtgggt
cgcaatgatgacgtcaaatgcttttgttgtgatggtggcttaaggtgttgggaatctgga
gacgacccgtgggtggagcacgccaagtggtttccaaggtgtgagttcttgattcgcatg
aaggggcaggattttgttgatgagattcaagctcgataccctcaccttcttgagcagctt
ttgtcaacttcagatactcctggagatgaaaatactgatccaccaattgttcattttggg
cctggagaaaattcctccgaagatgccgtcatgatgaacacgcccgtggtgaaagcggcc
ttggagatgggcttcagtagaaacttggtgaagcagaccgttcagagcaagatcctgacg
agcggggagaattacaaaacagtcagtgatattgtgttggcacttcttgatgctgaagat
gagaccagagaagaagagaaggaaagacaaactgaagagctggcatcagatgatctgtca
ttaattcggaggaacagaatggctctttttcaacagttgacgtgtgtgcttcctatcctg
gataatcttttaaaggccaatgtcattaataaacaggaacatgatattattaagcaaaaa
acacagatacctttgcaagcaagagaactgattgataccgttttggtcaaaggaaatgct
gctgccaacatcttcaaaagctgcttaaaagaaattgaccctacattatataagaactta
tttgtggacaagaacatgaagtatattccaacagaagatgtttcaggtctgtcgctggaa
gagcagctgaggaggctgcaggaggaaagaacctgcaaagtgtgcctggaccgagaagtg
tccatagtgttcattccctgcggccacctggtggtgtgccaagactgtgccccttccctc
agaaaatgccccatttgcaggggtataatcaagggcaccgtccggacctttctctcctaa

DBGET integrated database retrieval system