KEGG   Felis catus (domestic cat): 101080579
Entry
101080579         CDS       T02385                                 
Symbol
NDUFV2
Name
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101080579 (NDUFV2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101080579 (NDUFV2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101080579 (NDUFV2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101080579 (NDUFV2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080579 (NDUFV2)
   05012 Parkinson disease
    101080579 (NDUFV2)
   05014 Amyotrophic lateral sclerosis
    101080579 (NDUFV2)
   05016 Huntington disease
    101080579 (NDUFV2)
   05020 Prion disease
    101080579 (NDUFV2)
   05022 Pathways of neurodegeneration - multiple diseases
    101080579 (NDUFV2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101080579 (NDUFV2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101080579 (NDUFV2)
Enzymes [BR:fca01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101080579 (NDUFV2)
SSDB
Motif
Pfam: 2Fe-2S_thioredx
Other DBs
NCBI-GeneID: 101080579
NCBI-ProteinID: XP_003995070
Ensembl: ENSFCAG00000028157
UniProt: A0A337RZR2
LinkDB
Position
D3:complement(37385974..37418235)
AA seq 249 aa
MFFSAALRAKAAGLIAQWGRHIRNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVGNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgttcttctccgcggcgctccgggccaaggcggcaggcctcatcgcccagtggggaaga
catataaggaatttacataagacagctgtgcaaaatggagctggaggagccttatttgtt
cacagagatactcctgagaataacccagatactccatttgatttcacaccagaaaactat
aagaggatagaggcaattgtaggaaactatccagaaggacataaagcagcagctgtgctt
ccagtcctggatttagcccaaagacagaatggatggctgcccatctctgccatgaacaag
gttgcggaagttttacaggtacctccaatgagagtatatgaagtagcaactttttatacg
atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccttgc
atgcttcgaaactctgacagcatactggaggccatccagaaaaagcttggaataaaggtt
ggggagacgacacctgataaacttttcactcttatagaggtggaatgtttaggggcctgt
gtaaatgcaccaatggttcaaataaatgacaactactatgaggatctgacacctaaggat
attgaagaaattattgacgagctcaaagctggcaaaattccaaaacctgggccaaggagt
ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaagga
cctggctttggtgtgcaagcaggactttaa

KEGG   Felis catus (domestic cat): 101080736
Entry
101080736         CDS       T02385                                 
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 subunit C2
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101080736
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101080736
  09159 Environmental adaptation
   04714 Thermogenesis
    101080736
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101080736
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080736
   05012 Parkinson disease
    101080736
   05014 Amyotrophic lateral sclerosis
    101080736
   05016 Huntington disease
    101080736
   05020 Prion disease
    101080736
   05022 Pathways of neurodegeneration - multiple diseases
    101080736
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101080736
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101080736
SSDB
Motif
Pfam: NDUF_C2
Other DBs
NCBI-GeneID: 101080736
NCBI-ProteinID: XP_011284942
Ensembl: ENSFCAG00000029444
UniProt: M3XBJ5
LinkDB
Position
D1:56256687..56266069
AA seq 120 aa
MMSGRPGRVPLQFLPDEARSLPPPKLTDPRLVYMGFLGYCSGLIDNAIRRRPVVTAGLHR
QLLYVTSFVFIGYYLLKRQDYMYAVKDHDMFAYVKSHPEDFPEKDKKTYGDFLEEFHPVR
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatgagcggacggccgggccgagtgcccttacagttcctgccggatgaggcccggagc
ctcccaccgcccaagctgaccgacccgagactcgtctacatgggtttcttgggctactgc
tccggcctgattgataacgcgatccggcgaaggccggtggtgactgccggtttacatcgc
cagcttctatatgttacttcttttgtctttattggatattatcttttaaaacgtcaagat
tatatgtatgctgtgaaggaccatgatatgtttgcatatgtaaaatcacatccagaggat
tttcctgaaaaagataagaaaacttatggtgactttcttgaagaattccatccagtgcgt
tga

KEGG   Felis catus (domestic cat): 101081479
Entry
101081479         CDS       T02385                                 
Symbol
NDUFA12
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081479 (NDUFA12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101081479 (NDUFA12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101081479 (NDUFA12)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101081479 (NDUFA12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081479 (NDUFA12)
   05012 Parkinson disease
    101081479 (NDUFA12)
   05014 Amyotrophic lateral sclerosis
    101081479 (NDUFA12)
   05016 Huntington disease
    101081479 (NDUFA12)
   05020 Prion disease
    101081479 (NDUFA12)
   05022 Pathways of neurodegeneration - multiple diseases
    101081479 (NDUFA12)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101081479 (NDUFA12)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101081479 (NDUFA12)
SSDB
Motif
Pfam: NDUFA12
Other DBs
NCBI-GeneID: 101081479
NCBI-ProteinID: XP_003989165
Ensembl: ENSFCAG00000023050
UniProt: M3WRN3
LinkDB
Position
B4:complement(118549300..118579131)
AA seq 145 aa
MEFLQVLKRGLQQLSGHGGLRGYLRVFFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHR
WVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPPIARKFIWTNHKFNVSGT
PEQYVPYSTTRKKIQEWVPPSTPYK
NT seq 438 nt   +upstreamnt  +downstreamnt
atggagttcctgcaggtcctgaaacgcgggctgcagcagctcagcggccacggtggcctc
cgcggctatctacgagttttcttcagggcaaacgatgtgagggttggtacattagtgggg
gaagacaaatatggaaacaaatactatgaggacaacaagcaattttttggtcgtcaccga
tgggttatatatacaactgaaatgaatggcaagaacacgttttgggatgtggatggaagc
atggtcccccctgaatggcatcgttggcttcactctatgactgatgatcctccaacaaca
aaaccacctatcgctcgtaaattcatttggacaaaccataagttcaatgtgagtggcact
ccagaacaatatgtaccttattctaccactagaaagaagattcaagagtgggtcccacct
tcaacaccttacaagtaa

KEGG   Felis catus (domestic cat): 101081685
Entry
101081685         CDS       T02385                                 
Symbol
NDUFA3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 isoform X2
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081685 (NDUFA3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101081685 (NDUFA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101081685 (NDUFA3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101081685 (NDUFA3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081685 (NDUFA3)
   05012 Parkinson disease
    101081685 (NDUFA3)
   05014 Amyotrophic lateral sclerosis
    101081685 (NDUFA3)
   05016 Huntington disease
    101081685 (NDUFA3)
   05020 Prion disease
    101081685 (NDUFA3)
   05022 Pathways of neurodegeneration - multiple diseases
    101081685 (NDUFA3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101081685 (NDUFA3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101081685 (NDUFA3)
SSDB
Motif
Pfam: NADHdh_A3
Other DBs
NCBI-GeneID: 101081685
NCBI-ProteinID: XP_003997494
LinkDB
Position
E2:complement(4024870..4027243)
AA seq 115 aa
MRTRRLSEASGAGTTTPRVLRALAAAAYATKMAGRLTAFLKDVWAKEPVLVASFTIAGLA
VILPTISPFTKYATMINQATPYNYPVPLRDDGNMPDVPSHPQDPEGPSLEWLKKL
NT seq 348 nt   +upstreamnt  +downstreamnt
atgcgcacgcgcagactcagcgaagcctccggcgcagggaccacaactcccagagtgctc
cgcgctcttgccgccgccgcctacgcgaccaagatggccgggagactcaccgccttcctc
aaggatgtctgggccaaggagccggtgctggtcgcgtccttcaccatcgcgggcctcgct
gtaattctgcccaccatcagccccttcaccaaatatgccaccatgatcaaccaggccacg
ccctacaactatccagtgcccctccgagatgatgggaacatgcctgacgtgcccagccac
ccccaggaccctgagggtccaagcttggagtggctgaagaaactgtga

KEGG   Felis catus (domestic cat): 101082389
Entry
101082389         CDS       T02385                                 
Symbol
NDUFB2
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101082389 (NDUFB2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101082389 (NDUFB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082389 (NDUFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101082389 (NDUFB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082389 (NDUFB2)
   05012 Parkinson disease
    101082389 (NDUFB2)
   05014 Amyotrophic lateral sclerosis
    101082389 (NDUFB2)
   05016 Huntington disease
    101082389 (NDUFB2)
   05020 Prion disease
    101082389 (NDUFB2)
   05022 Pathways of neurodegeneration - multiple diseases
    101082389 (NDUFB2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101082389 (NDUFB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101082389 (NDUFB2)
SSDB
Motif
Pfam: NADH_B2
Other DBs
NCBI-GeneID: 101082389
NCBI-ProteinID: XP_003983159
Ensembl: ENSFCAG00000027401
LinkDB
Position
A2:156959938..156968222
AA seq 105 aa
MSALKRLAPFFPVGNRLFKGRGSGAAGGTGVRHAGDGVHIEPRYRQFPQLTKSQVIQAEF
FSGTMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDED
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcggctctgaagcggttggcgcctttctttccggttggaaaccgcttgttcaaaggc
cgcggctccggggcggctggaggcactggagtccgtcatgccggtgacggggtgcatatc
gagcctcggtataggcagtttccccagctgaccaagtcccaggtgatccaggccgagttc
ttcagtgggaccatgtggttctggattctctggcgtttttggcatgactcggatgctgtg
ctgggtcactttccatatccagatccttcccagtggacagatgaagaactaggtatcctc
cctgatgacgaagactga

KEGG   Felis catus (domestic cat): 101083475
Entry
101083475         CDS       T02385                                 
Symbol
NDUFB10
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101083475 (NDUFB10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101083475 (NDUFB10)
  09159 Environmental adaptation
   04714 Thermogenesis
    101083475 (NDUFB10)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101083475 (NDUFB10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101083475 (NDUFB10)
   05012 Parkinson disease
    101083475 (NDUFB10)
   05014 Amyotrophic lateral sclerosis
    101083475 (NDUFB10)
   05016 Huntington disease
    101083475 (NDUFB10)
   05020 Prion disease
    101083475 (NDUFB10)
   05022 Pathways of neurodegeneration - multiple diseases
    101083475 (NDUFB10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101083475 (NDUFB10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101083475 (NDUFB10)
SSDB
Motif
Pfam: NDUFB10 MetOD1
Other DBs
NCBI-GeneID: 101083475
NCBI-ProteinID: XP_003998996
Ensembl: ENSFCAG00000011738
LinkDB
Position
E3:complement(42977860..42980888)
AA seq 176 aa
MPDSWDKDVYPEPPRRTPAPSPKTSLPNPITYVTKAFDLLVDRPVTLVREFIERQHAKNR
YYYYHREFRRVPDITECQEKDVLCMFEAEMQWRRDYKVDQEIVNIIQERLKACQQREGES
YRENCAKEMEQFAQVAKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKAAKEAAAA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgccggatagctgggataaggacgtgtaccccgagcccccgcgccgcacaccggcgccc
tcgccgaagacctcgctgcccaaccccataacctatgtgacgaaggccttcgatctcctc
gtggaccgacctgtgaccctagtgagagagtttatagagcggcagcatgcgaagaacagg
tattactactaccatcgggagttccgtcgtgtgccagacatcaccgagtgccaggaaaag
gatgtcttgtgcatgtttgaagcagaaatgcaatggaggagagactataaagttgatcaa
gaaatcgtcaatattatccaggaaaggctgaaggcgtgtcagcagagggaaggcgagagc
tacagggagaactgcgccaaggagatggagcagtttgcccaggtggccaaggcctaccag
gaccgctatcacgacctgggtgcccattattcagccagaaagtgcctggcgaagcagaag
cagcggatgctggcagagagaaaagctgctaaagaggccgccgctgcgtga

KEGG   Felis catus (domestic cat): 101084209
Entry
101084209         CDS       T02385                                 
Symbol
NDUFA6
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084209 (NDUFA6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101084209 (NDUFA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101084209 (NDUFA6)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101084209 (NDUFA6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084209 (NDUFA6)
   05012 Parkinson disease
    101084209 (NDUFA6)
   05014 Amyotrophic lateral sclerosis
    101084209 (NDUFA6)
   05016 Huntington disease
    101084209 (NDUFA6)
   05020 Prion disease
    101084209 (NDUFA6)
   05022 Pathways of neurodegeneration - multiple diseases
    101084209 (NDUFA6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101084209 (NDUFA6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101084209 (NDUFA6)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2
Other DBs
NCBI-GeneID: 101084209
NCBI-ProteinID: XP_003989398
Ensembl: ENSFCAG00000025921
UniProt: M3WRH9
LinkDB
Position
B4:complement(137511212..137520179)
AA seq 128 aa
MAASGLRRAAVAAPTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDITVKQGR
DKVREMFMKNAHVTDPRVVDLLVIKGKMELEETINVWKQRTHVMRFFHETEAPRPTDFLS
KFYIGHDP
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcggcgagcgggctccggcgagctgcagtcgcggctcccacttcagtgaaacccatt
tttagtcgggacatgaacgaagccaagcggagggtgcgcgagttgtaccgcgcctggtat
cgagaggtgccgaacactgtgcacttattccagctagacatcaccgtgaaacagggacgg
gataaagtccgagaaatgttcatgaagaatgcccacgtcacggaccccagggtggttgat
cttctggtcattaagggaaagatggaactggaggaaacaattaacgtctggaagcagcgg
acacacgttatgcggttcttccatgaaacagaagcgccgaggccgacggatttcctgtcc
aagttctacattggccacgacccgtga

KEGG   Felis catus (domestic cat): 101084817
Entry
101084817         CDS       T02385                                 
Symbol
NDUFV3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084817 (NDUFV3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101084817 (NDUFV3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101084817 (NDUFV3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101084817 (NDUFV3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084817 (NDUFV3)
   05012 Parkinson disease
    101084817 (NDUFV3)
   05014 Amyotrophic lateral sclerosis
    101084817 (NDUFV3)
   05016 Huntington disease
    101084817 (NDUFV3)
   05020 Prion disease
    101084817 (NDUFV3)
   05022 Pathways of neurodegeneration - multiple diseases
    101084817 (NDUFV3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101084817 (NDUFV3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101084817 (NDUFV3)
SSDB
Motif
Pfam: NDUFV3 AF-4 IMUP
Other DBs
NCBI-GeneID: 101084817
NCBI-ProteinID: XP_011284082
LinkDB
Position
C2:complement(3282032..3294929)
AA seq 472 aa
MAASLLLRQGRSGAMKTMLLDARVFRGLAPSVSLSAESGKSKKGLPPNPKKQSPPKNVVE
PKERGQLVATPTAAELSKNLSSPRAHPSVVSAGGLVAGPGPGPEGSMLFTAEGAPEFRLR
KTVVETPQKVPSPLRKQGTDAKALRENRGDDSSSSSSSSSSSDSDSEGEGESSTADPQGT
SRGRGGPPRPQASRPLEDGAPRIAVVAKEKPRSQPDVPPPERPRPVKKKGGTIKPPEDRK
DTKRKTTTPKSQADKEFMKQNVKEKQFQKVLRSSETDKEGQKLPKVKEVLPAHTESGLST
QPAGGPAPIQWRERTGTARPPPAAPEASERHRGQHAAERGGEVAFPLFSKENLGAQVTEG
TLKAAGETLEGQAPVRSLKPVPAPSEGDFQDKAAGPEPEGGAGMAEDPAPPGGPDGTQES
AHAASASEPLDNATYKNLQHHDYTPYTFLDLNLDLSKFRMPQPSSGRESPRH
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcggcctctcttctgctgcggcaaggacggtcgggggcaatgaagactatgctccta
gacgcacgagtgtttcgaggacttgctccctcagtgtctctctctgcggaatcagggaag
agcaaaaagggactgccaccaaatcccaagaagcaaagtccaccaaaaaatgtagtggaa
ccaaaggagaggggccaactcgtagccaccccaacagcagctgaattgtctaaaaacttg
tcttcaccccgtgctcacccgtcagttgtgagtgcgggcgggctggtagctggccccggc
cccggccccgaaggcagcatgctattcacagccgaaggggctccggagttccggttgcga
aagactgtcgtagagacgcctcagaaagttccgtctccactcaggaagcagggcacggat
gcaaaagctcttagggagaacaggggagatgattcatcttcatcgtcctcttcgtccagc
tcctccgattccgactccgagggggaaggggagagctccacagctgacccccaggggacg
agcaggggcagaggagggcctcccagaccgcaggcgtcccgccccctcgaagatggagcc
cccagaattgcagtagtcgccaaagagaagccccgctcgcagccagatgtcccccctccc
gagaggccccgtccggtcaagaagaaagggggcaccatcaagccaccagaggacagaaaa
gacacaaaacgcaaaaccacaacacccaagtcacaagcagataaagagtttatgaagcaa
aacgtcaaggaaaagcaattccagaaagttcttagatcaagtgaaaccgataaagaaggc
caaaagctgcccaaagtcaaagaagtcctgcctgctcatacagagtcaggattgtccaca
cagccggctggcggcccagcgccaattcagtggagggaaagaactggaacagcaagaccg
ccgccagccgctcctgaggccagcgagagacaccggggccaacacgcagcggagcgtggt
ggggaggtggctttccccctgttcagcaaagaaaatttgggggcgcaggtgacagaggga
accctgaaggccgcgggagagactctggaaggtcaggcgccagtccgaagtttgaagccg
gttcctgctcctagcgaaggcgatttccaggacaaggccgcgggcccagagcctgagggc
ggggccgggatggcagaagaccctgcccctccaggagggccggacggcacccaggagtcc
gctcacgccgccagcgcctccgagccactggacaacgccacctacaagaacctgcagcac
cacgactataccccgtacaccttcttagacctcaacctggacctgtccaagttcaggatg
ccccagccctcgtcaggacgggagtcccctcgccactga

KEGG   Felis catus (domestic cat): 101085609
Entry
101085609         CDS       T02385                                 
Symbol
NDUFA1
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085609 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101085609 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101085609 (NDUFA1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101085609 (NDUFA1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085609 (NDUFA1)
   05012 Parkinson disease
    101085609 (NDUFA1)
   05014 Amyotrophic lateral sclerosis
    101085609 (NDUFA1)
   05016 Huntington disease
    101085609 (NDUFA1)
   05020 Prion disease
    101085609 (NDUFA1)
   05022 Pathways of neurodegeneration - multiple diseases
    101085609 (NDUFA1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101085609 (NDUFA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085609 (NDUFA1)
SSDB
Motif
Pfam: MWFE zf-C5HC2
Other DBs
NCBI-GeneID: 101085609
NCBI-ProteinID: XP_004000887
UniProt: A0A2I2UTG4
LinkDB
Position
X:100435999..100439954
AA seq 70 aa
MWFEILPGLGIMAVCLVIPGIATAHIHRFCNGGKEKRVAYYRYQWSLMQRDRRISGVNRY
YVSKGLENID
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtggttcgagattctgcccggcctcggcatcatggccgtgtgcttggtcatccccggc
atagccactgcgcacatccacaggttctgtaacgggggcaaggaaaaaagggttgcctat
tatcggtatcagtggagtttgatgcaaagagacaggcgcatctctggagttaatcgttac
tatgtgtcaaagggtttggaaaatattgattaa

KEGG   Felis catus (domestic cat): 101085859
Entry
101085859         CDS       T02385                                 
Symbol
NDUFB9
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085859 (NDUFB9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101085859 (NDUFB9)
  09159 Environmental adaptation
   04714 Thermogenesis
    101085859 (NDUFB9)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101085859 (NDUFB9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085859 (NDUFB9)
   05012 Parkinson disease
    101085859 (NDUFB9)
   05014 Amyotrophic lateral sclerosis
    101085859 (NDUFB9)
   05016 Huntington disease
    101085859 (NDUFB9)
   05020 Prion disease
    101085859 (NDUFB9)
   05022 Pathways of neurodegeneration - multiple diseases
    101085859 (NDUFB9)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101085859 (NDUFB9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085859 (NDUFB9)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N DUF2066
Other DBs
NCBI-GeneID: 101085859
NCBI-ProteinID: XP_004000162
Ensembl: ENSFCAG00000004678
UniProt: A0A337SB28
LinkDB
Position
F2:69643867..69650970
AA seq 179 aa
MAFCAPGAYLTHQQKVLRLYKRALRHLESYCVHRDKYRYFACLLRARFEEHKNEKDMVKA
TQLLREAEEEFWHNQHPQPYVFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFA
KREQWKKLRRESWEREVKQLQEETPVGGPNTEALPPARKEGDLPPLWWHIVTRPRERPM
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgttctgcgcgccgggtgcctacctgacccaccagcagaaggtgttgcggctttat
aagcgggcgctgcgccacctggagtcgtattgtgtccacagggacaaataccgctacttt
gcttgtttgctgagagctcggtttgaagaacataagaatgaaaaggatatggtgaaggcc
acccaactgctgagggaggcagaggaagaattctggcacaatcagcaccctcagccgtac
gtcttccccgagtctccaggagggacctcctacgagagatatgagtgctacaaggttcct
gagtggtgcttagacgactggcatccgtccgagaaggcgatgtatccagactactttgcc
aagagagagcagtggaagaagctgcggagggagagctgggagcgggaggtcaagcagctg
caggaggaaaccccagtcggtggtcccaacactgaagctttgcccccggcccgaaaggaa
ggcgatttgccccccctgtggtggcatattgtgaccaggccccgggagcggcccatgtag

DBGET integrated database retrieval system