KEGG   Felis catus (domestic cat): 101080675
Entry
101080675         CDS       T02385                                 
Symbol
PLCG2
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04020  Calcium signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101080675 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101080675 (PLCG2)
   04014 Ras signaling pathway
    101080675 (PLCG2)
   04370 VEGF signaling pathway
    101080675 (PLCG2)
   04064 NF-kappa B signaling pathway
    101080675 (PLCG2)
   04066 HIF-1 signaling pathway
    101080675 (PLCG2)
   04020 Calcium signaling pathway
    101080675 (PLCG2)
   04070 Phosphatidylinositol signaling system
    101080675 (PLCG2)
   04072 Phospholipase D signaling pathway
    101080675 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101080675 (PLCG2)
   04613 Neutrophil extracellular trap formation
    101080675 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    101080675 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    101080675 (PLCG2)
   04662 B cell receptor signaling pathway
    101080675 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    101080675 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    101080675 (PLCG2)
   04670 Leukocyte transendothelial migration
    101080675 (PLCG2)
   04062 Chemokine signaling pathway
    101080675 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101080675 (PLCG2)
   04919 Thyroid hormone signaling pathway
    101080675 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101080675 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101080675 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    101080675 (PLCG2)
   04380 Osteoclast differentiation
    101080675 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101080675 (PLCG2)
   05206 MicroRNAs in cancer
    101080675 (PLCG2)
   05205 Proteoglycans in cancer
    101080675 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101080675 (PLCG2)
   05214 Glioma
    101080675 (PLCG2)
   05223 Non-small cell lung cancer
    101080675 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101080675 (PLCG2)
   05171 Coronavirus disease - COVID-19
    101080675 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080675 (PLCG2)
   05169 Epstein-Barr virus infection
    101080675 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101080675 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101080675 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101080675 (PLCG2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101080675 (PLCG2)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101080675 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101080675 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH PH_12 SH3_2 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 101080675
NCBI-ProteinID: XP_019675679
Ensembl: ENSFCAG00000004987
UniProt: M3W393
LinkDB
Position
E2:57397221..57550070
AA seq 1265 aa
MTAMVNMDTLPEYEKSQIKRTLELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAARQKEDCCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFVEIGAHKDELSFEQFHVFYKNLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLLHEQQEVWAQDLNKVRERMTKFIDDTLRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDIQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEKR
TNAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSVMEGGTMKYF
LTDNIMFTSIYDLIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKMDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMQPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccgccatggtcaacatggacacccttcctgaatatgagaagagtcagatcaagaga
accctggagctgggcacggtgatgaccgtgttcagctttcgcaagtctaccccggagcgg
aggactgtccaggtgatcatggagacgcggcaggtggcctggagcaagacggctgacaag
attgaaggcttcttggatatcatggaaatcaaggaaatccgccccgggaagaactccaag
gattttgagcgcgcgaaggcagcccggcagaaggaggactgctgtttcaccatcttgtac
ggcacccagttcgtcctgagcactctcagtttggcagctgattctaaagaagacgcgact
aagtggctctctggcttgaaaatcttacaccaggaagcgatgagtgcgtctacgcccacc
attattgagagttggctgagaaagcagatttattcagtggatcaaaccagaagaaacagc
atcagcctccgagagctgaagaccatcttgcccctggtcaacttcaaagtgaacagtgcc
aagttcctcaaagataagtttgtggaaatcggcgctcacaaagatgaactcagctttgag
cagttccacgttttctataaaaatcttatgtttgagcagcaaaagtcgattcttgatgaa
ttcaaaaaagattcttccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gtttacctgcacgacttccagcggtttctcctacacgaacagcaggaggtttgggctcag
gatctgaacaaagtccgcgagcgaatgacaaagtttatcgatgacaccctgagggagacc
gccgagcccttcctgtttgttgatgagttcctcacgtacctgttttcgcgggagaatagc
atctgggatgagaagtatgacgtcgtggacatacaggacatgaacaaccccttgtcccat
tactggatctcctcctcacataacacgtacctcaccggtgaccagctgcggagcgagtcg
tccacggaggcatacatccgctgcctgcgcatgggctgtcgctgcatcgagctggactgc
tgggacgggcccgatgggaagcccatcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccatgcctttgtcacctcaagcttcccg
gtgatcctgtccatcgaagagcactgctgtgtggagcagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgacctgctgttgacgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacgtggaagataagaaagatgagcacaagcaacagggtgaa
ctgtacatgtgggattccattgaccagaaatggacccggcactactgtgccatcgctgat
gccaagctgtcgttcagcgatgacattgagcagactgcagaggaggagctgccccaggat
ataccccccacggagctgcattttggggaggagtggttccacaagaaggtggagaagaga
acaaacgccgagaagctgctgcaggaatactgtgccgagacggggggcaaagatgggacc
ttcttggtgcgggagagcaagaccttccccaacgactacaccctgtccttctggcggtcc
ggccgggtccagcactgccggatccgctccgtcatggagggcgggaccatgaagtacttc
ctgactgacaacatcatgttcaccagcatctatgacctcatccagcactaccgtgagacg
cacctgcgctgtgccgagttcgagctccggctcaccgaccccgtgcccaaccccaacccc
cacgagtcaaagccgtggtactatgatggcctgagccgcggggaagcagaggacatgctg
atgagagttccccgggacggggccttcctgatccggaggcgggaaggtaccgactcctac
gccatcaccttcagggccaggggcaaagtaaagcattgccgcatccatcgggacggccgg
cactttgtgctggggacctctgcctacttcgagagcctcgtcgagctggtcagttactac
gagaagcacgcgctgtaccggaagatgcggctgcgctatcctgtgacgcctgagctgctg
gagcgctacaatatggaacgagatatcaactccctctatgacgtcagcaggatgtatgtg
gatcccagtgaaatcaacccgtccatgcctcagaggaccgtcaaagctctgtatgactac
aaagccaagcgaagcgatgagctgagcttctgccgtggggccctcattcacaacgtctcc
aaggagccctggggctggtggaaaggagactatgggaccaggatccagcaatacttccca
tccaactatgttgaggacatttcaacggtcgatgtggaagaactggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataacgtc
gtgaaagccccgcaggggaaaaaccagaaggcgttcgtgttcatcctggagcccaagaag
caaggcgaccctccggtggagtttgccacagacagggtcgaggagctctttgagtggttt
cagagcatccgggagatcacctggaagatggacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctggtagtctactgcaagcccacc
agcaagaccaaggacaatttagaaaaccccgacttccgagaaatccgctccttcgtggag
acgaaggctgacagtgtcgtcagacagaaaccggtcgacctcctcaagtacaatcagaag
ggcctgacccgtgtttacccgaagggacagagggtggactcctccaactacgaccccttt
cgcctctggctatgtggctcccagatggtggcactcaatttccagactccagacaagtac
atgcagatgaatcaagccttgttctcactcaacgggcggacaggctacgtcctgcagccc
gagagcatgaggacggagaagtacgaccccatgccgcccgaatcccagcggaagattctg
atgactctgaccgtcaaggttctcggggctcgccatctccccaaacttggccgaagcatc
gcatgtccctttgtggaggtggaaatctgcggggctgaatatgacaacaacaagtttaag
accacagttgtgaatgacaatggcctaagccccgtttgggctccgacacaggagaaggtg
acctttgaaatttatgacccaaacctcgcgtttctgcgctttgtggtctacgaggaagat
atgttcagtgatcctaacttcctcgctcatgccacttaccccatcaaaggaatcaaatca
ggattcagatctgttcctctgaagaacgggtacagtgaagatatcgagctggcttccctc
ctggtgttctgtgagatgcagccagtcctggagagtgaagaggaactctactcctcctgc
cgccagctgcgaaggcggcaggaagagctgaacaaccagctgttcctgtacgacacacac
cagaatctgcgcaatgccaaccgggatgccctcgtcaaagagttcaacgtcaacgagaac
cagctccagctgtaccaggagaagtgcaaccggaggttaagagagaagagagttagcaac
agtaggttttactcatag

KEGG   Felis catus (domestic cat): 101092925
Entry
101092925         CDS       T02385                                 
Symbol
PLCG1
Name
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04613  Neutrophil extracellular trap formation
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04935  Growth hormone synthesis, secretion and action
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05135  Yersinia infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101092925 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101092925 (PLCG1)
   04014 Ras signaling pathway
    101092925 (PLCG1)
   04015 Rap1 signaling pathway
    101092925 (PLCG1)
   04370 VEGF signaling pathway
    101092925 (PLCG1)
   04064 NF-kappa B signaling pathway
    101092925 (PLCG1)
   04066 HIF-1 signaling pathway
    101092925 (PLCG1)
   04020 Calcium signaling pathway
    101092925 (PLCG1)
   04070 Phosphatidylinositol signaling system
    101092925 (PLCG1)
   04072 Phospholipase D signaling pathway
    101092925 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101092925 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    101092925 (PLCG1)
   04660 T cell receptor signaling pathway
    101092925 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    101092925 (PLCG1)
   04659 Th17 cell differentiation
    101092925 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    101092925 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    101092925 (PLCG1)
   04670 Leukocyte transendothelial migration
    101092925 (PLCG1)
   04062 Chemokine signaling pathway
    101092925 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101092925 (PLCG1)
   04919 Thyroid hormone signaling pathway
    101092925 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101092925 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101092925 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    101092925 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101092925 (PLCG1)
   05206 MicroRNAs in cancer
    101092925 (PLCG1)
   05205 Proteoglycans in cancer
    101092925 (PLCG1)
   05231 Choline metabolism in cancer
    101092925 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101092925 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101092925 (PLCG1)
   05214 Glioma
    101092925 (PLCG1)
   05223 Non-small cell lung cancer
    101092925 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101092925 (PLCG1)
   05171 Coronavirus disease - COVID-19
    101092925 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101092925 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101092925 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101092925 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    101092925 (PLCG1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101092925 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101092925 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092925 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092925 (PLCG1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101092925 (PLCG1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101092925 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101092925 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9 PH_20
Other DBs
NCBI-GeneID: 101092925
NCBI-ProteinID: XP_023107018
Ensembl: ENSFCAG00000009032
LinkDB
Position
A3:complement(19251747..19288269)
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRTDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
VERPELCRVSLPEFQQFLLEYQGELWAIDQLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPETMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVVLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKAGYRAVPLKNNYSEDL
ELASLLIKIEVFPAKQENGDVSPFSSMSLRERGSDASGQLFHGRGREGSFEARYQQPFED
FRVSQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaatggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccggagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgtggcgccgacaagatcgagggggccattgacattcgagaaatcaaggag
atccgcccagggaagacctcacgggattttgatcgctaccaagaggatcctgctttccga
acagaccagtcacactgctttgtcatactgtatgggatggagttccgcctgaagaccctg
agcctgcaagctacatctgaggatgaagtgaacatgtggatcaaggggttaacttggctg
atggaagatacattgcaggcggccacacctctgcagattgaaaggtggctgaggaagcag
ttctattcggtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcgtctgacggac
ctggagcagcgcagcagtgacatcacctatgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtgccctgagggcg
gtggagcggccggagctctgtcgcgtgtcccttcctgagttccagcagttcctcctcgag
taccagggggagctgtgggccatcgaccagcttcaggtgcaagaatttatgctcagcttt
ctccgagaccccttgcgagagattgaagagccgtacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcacagctggatgcagtgtgcccagaa
accatgaacaaccccctctcccactactggatctcctcctcccacaacacatacctgacc
ggggaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggatggcccagatgggatgccagtcatttaccat
ggacacacccttaccaccaagatcaagttctcagacgtcctgcacactatcaaggagcac
gcctttgtggcctcagagtacccggtcatcctgtccattgaggaccattgcagcattgcc
cagcagaggaacatggcacagtacttcaagaaggtgcttggggacacactccttaccaag
cctgtggacatcgctgccgatggactcccctcacccaaccagctcaagaggaagatcctt
atcaagcacaagaagctggcagagggcagtgcctatgaagaggtgcctacatcagtgatg
tactccgagaacgatatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccacgagtggtatccccactacttcgtcctgaccagcagcaaaatctactactct
gaggagacgagcagtgaccagggcaacgaggatgaggaggagcccaaggaggccagtggc
agcacagagctgcactccagtgagaaatggttccacgggaagctcggggcaggacgggat
gggcggcacatcgctgagcgcctgcttaccgagtactgcattgagaccggggcccctgat
ggctccttcctcgtgcgagagagcgagaccttcgtgggcgactataccctctctttctgg
cggaatgggaaagtccagcactgccggatccactctcggcaggacgctggggcccccaag
ttcttcttgacagacaacctggtctttgactcgctctatgacctcatcacacactaccag
caggtgcccctacgctgcaacgaatttgagatgcgcctctcagagccagtcccgcagacc
aatgcccacgagagcaaagagtggtaccatgccagcctgaccagagctcaggccgagcac
atgctgatgcgcgtcccccgggatggggccttcctggtgaggaaacggaatgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcattgccgcgtccagcaggag
ggccagacggtggtcctgggcaactcagagttcgacagcctcgtggacctcatcagctac
tacgagaagcacccactgtaccgcaagatgaagctgcgctatcccatcaacgaggaggcg
ctggagaagatcggcacagctgagccagactacggggccctgtatgagggccgcaaccca
ggcttctatgtggaggcgaatcctatgccgactttcaagtgtgcagtcaaagcactcttt
gactacaaggcccagagagaggatgagctgactttcactaagagcgccatcatccagaac
gtggagaagcaagaaggtggctggtggcggggggactatggtgggaagaagcagctgtgg
ttcccgtcaaactacgtggaagagatggtcagccccgcagccctggagcctgagagggag
cacttggacgagaacagccccttgggggatttgctccggggggtcttggatgtgccagct
tgtcagattgccatccgtcccgagggcaagaacaaccggctgttcgtcttctccatcagt
atggcttccgtggcgcactggtccctggatgtcgctgctgactcacaagaggagctgcag
gactgggtgaagaagatccgagaagtggcccagacggcagacgccaggctcacggagggc
aagatgatggagcggaggaagaagatcgccctggagctctccgagctggttgtctactgt
cgacctgttccctttgatgaagagaagattggcacagaacgtgcctgctaccgggacatg
tcgtccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttt
ctccagtacaaccggctgcagctctcccgcatctaccccaagggccagcggctggactct
tccaattacgaccccttgcccatgtggatctgtggcagtcagctcgtggctctcaacttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggccggtggccactgt
ggctacgtgctgcagccgagcaccatgcgggatgaggcctttgatccctttgacaagagc
agcctccgaggcctggagccatatgccatctgcatcgaggtgctgggggcccggcacctg
ccgaagaatggccgaggcatcgtgtgtccttttgtggagattgaggtggccggagcagag
tatgacagcatcaaacagaagacagaatttgtggtggacaacggactgaaccctgtttgg
cccgccaagcccttccacttccagatcagtaacccagaattcgccttcctgcgctttgtg
gtgtatgaggaggacatgttcagtgaccagaacttcctggctcaggccaccttcccagta
aagggcttgaaggcaggatacagagccgtgcctttgaagaacaactacagtgaggacctg
gagctggcctccctgctcatcaagatcgaggttttccctgccaagcaggagaacggtgac
gtcagtcccttcagtagcatgtctctgcgcgagcggggctccgatgcctcgggtcagctg
ttccatggccggggccgggaaggttcctttgaagcccgctaccagcagccgtttgaggac
tttcgtgtctcccaagagcatctggcagaccattttgacagtcgggaacggagggcccca
cgaaggactcgggtcaacggggacaaccgcctctag

DBGET integrated database retrieval system