KEGG   Felis catus (domestic cat): 101080705
Entry
101080705         CDS       T02385                                 
Symbol
IL1R1
Name
(RefSeq) interleukin-1 receptor type 1 isoform X1
  KO
K04386  interleukin 1 receptor type I
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04640  Hematopoietic cell lineage
fca04659  Th17 cell differentiation
fca04750  Inflammatory mediator regulation of TRP channels
fca05146  Amoebiasis
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101080705 (IL1R1)
   04064 NF-kappa B signaling pathway
    101080705 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101080705 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101080705 (IL1R1)
   04659 Th17 cell differentiation
    101080705 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101080705 (IL1R1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101080705 (IL1R1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080705 (IL1R1)
   05163 Human cytomegalovirus infection
    101080705 (IL1R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101080705 (IL1R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101080705 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101080705 (IL1R1)
   04090 CD molecules [BR:fca04090]
    101080705 (IL1R1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL1 receptor family
   101080705 (IL1R1)
CD molecules [BR:fca04090]
 Proteins
  101080705 (IL1R1)
SSDB
Motif
Pfam: TIR Ig_3 Ig_2 I-set ig Ig_6 Ig_5 TIR_2 Adeno_E3_CR1 UPF0113
Other DBs
NCBI-GeneID: 101080705
NCBI-ProteinID: XP_003983933
Ensembl: ENSFCAG00000012152
UniProt: M3WGF1
LinkDB
Position
A3:complement(60429994..60509068)
AA seq 572 aa
MKVLLRLCFIAVLISSLEADTCEEREEKVVLVSSAYEIDVRSCLLNPNEKKGTIIWYKND
SKTPISMEVDSRIHQHKDKLWFVPAKVEDSGHYYCAVRNSTYCLKIKIAIKFVQHEPNLC
YNAEAIFTQKLPIARDGQLVCPYLDFFRDEKHELPKIQWHKDCKPLLLDNVNFTGLTNRL
IMTNVTAAHKGNYTCQASYTYLGKQYRITRVIELLTLEEDKPVKPIIVSPTNETMEASLG
SRLQLICNVSGQLSDFVYWKWNGSLIDEDDPVLVEDYLPVENPSTKRKNTIITVLNISEV
ESRFYLYPFTCVAKNTDGINSAYIQLIHPVPDFKKHTIGVFVMLTLVITCSVFIYKIFKV
DIVLWYRDSCYDFLPPKASDGKTYDAYILYPKTLGEGSTSNSDIFVFKVLPEVLEKQCGY
KLFIYGRDAYVGEDIVDVTNENIKKSRRLIIVLVPEASGLGWLENSSEEQIAMYNAFIQD
GIKVVLLELETIQDYEKMPETIKFIKRKHGAIRWSGDFREGVQSAKTRFWKNVRYHMPVQ
RQPPSSKHQLLSLAMRPDSKKKLQREVHVPLG
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgaaagtgttactcaggctttgtttcatagctgtactgatttcttctctggaagccgat
acttgtgaggagcgtgaagaaaaagtagttttagtttcatctgcgtatgaaattgatgtt
cgttcatgtcttcttaacccgaatgaaaagaaaggcactataatttggtataaaaatgac
agcaagacacctatatctatggaagtagactccaggattcatcagcacaaagataaactt
tggtttgttcccgctaaggtagaggattcgggacattactattgtgcagtaagaaattca
acttactgcctcaaaattaaaatagctattaagtttgtgcagcatgaacctaacttgtgt
tacaatgcagaagctatatttacacagaaactacccattgcaagagatggacaacttgtg
tgtccttatttggatttttttagagacgaaaagcatgagttacccaaaatacagtggcat
aaggattgcaaacctctactacttgacaatgtgaactttactggactgacaaatagactc
atcatgacgaatgtgactgcagcacataaggggaactatacttgtcaagcatcctataca
tacttgggaaagcagtatcgtattacccgggttatagaacttctcactctagaggaagac
aagcctgtgaagcctataattgtgagtccaactaatgagacaatggaagcaagtctggga
tccaggctacagttgatctgcaatgtcagtggccagttgagtgactttgtctactggaag
tggaatgggtcattaattgatgaagacgacccagtgttggtggaggattatttgccagtg
gaaaatccttcaaccaaaagaaagaacacaatcatcacagtacttaatatttcagaagtg
gaaagtagattttatctatatccatttacctgtgtagccaagaatacagatggtataaat
tcagcatatatccaattgatacatccagtccctgatttcaagaagcacacaattggtgtg
tttgtcatgttaactctagtaattacatgctctgttttcatctacaaaatcttcaaggtt
gacattgtgctttggtacagggattcttgctatgattttctccctccaaaagcttcagat
ggaaagacctatgatgcatatatactatatccaaagacccttggggaagggtccacctcg
aactcagatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtggatat
aagctgttcatttatggaagggacgcctatgttggggaagacattgttgatgtcactaat
gaaaacataaagaaaagcagaagactgatcatcgttttggtcccagaggcatcaggattg
ggctggctggagaattcatctgaagagcagatagcaatgtacaatgctttcattcaggat
gggattaaagttgtcctgcttgaactggagacgatccaagactatgagaaaatgccagaa
accattaaattcattaagcggaaacatggggccatacgctggtcaggggactttagagag
ggcgtgcagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgcccgtccag
cggcagccaccttcatccaaacaccagttactgtccttggccatgagaccagactcgaag
aaaaagcttcagagggaggtgcatgtgcctctcgggtag

KEGG   Felis catus (domestic cat): 101080961
Entry
101080961         CDS       T02385                                 
Symbol
IL1R2
Name
(RefSeq) interleukin-1 receptor type 2 isoform X2
  KO
K04387  interleukin 1 receptor type II
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04640  Hematopoietic cell lineage
fca05146  Amoebiasis
fca05166  Human T-cell leukemia virus 1 infection
fca05202  Transcriptional misregulation in cancer
fca05215  Prostate cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101080961 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101080961 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101080961 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101080961 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080961 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101080961 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101080961 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101080961 (IL1R2)
   04090 CD molecules [BR:fca04090]
    101080961 (IL1R2)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL1 receptor family
   101080961 (IL1R2)
CD molecules [BR:fca04090]
 Proteins
  101080961 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set V-set Ig_6 Ig_5 Izumo-Ig LPD11 Stevor
Other DBs
NCBI-GeneID: 101080961
NCBI-ProteinID: XP_003983934
LinkDB
Position
A3:complement(60591290..60626214)
AA seq 413 aa
MQGCRLGGAEPEITSRVLQKLLETMFVLYVLIIGVYSFTVQPEEHTVAAGNCQFLGKHFK
TDFKVEGEPVVLKCPQAQYWLRESVSPHVNVTWHKNDSARTIPGEEETRMWVQDGALWIL
PALQEDAGTYLCTVRNTSYCDEMSTELRVFEKTEASLPFISYPQILTLSTSGSLVCPELS
EFIRNKMDMKIQWYKDSVLLDQDNEKFLSVRGTSRLLIHNVSVEDAGYYSCAMTFAHEGM
QYNVTRNIELRVNKKEEETIPVIISPHQTILASLGSRLTIPCKVFLGAGTHSTTMLWWMA
NTTSIESAYQGGRVTEGQRQEYSENNENYIEVPLIFDPVIREDLNTDFKCVVRNTLSTQM
LRTTVKEAATFSWGIALAPLSLVFLVLVGIWMHRRYKHRTGKTYGLTTLKTGP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcagggctgcagattagggggtgctgaacctgagatcacctcccgtgtccttcagaag
ttgctggaaacaatgttcgtcttgtacgtgttgataatcggcgtttattccttcaccgtt
cagcctgaggaacacacagtggctgcaggaaactgccagtttcttggcaagcatttcaaa
actgacttcaaagtggaaggggagcctgtggtcctgaagtgcccccaggcgcagtattgg
ttgcgggagtctgtcagcccccacgtcaacgtgacatggcataaaaatgattctgctaga
acgattccaggggaagaagagacacgaatgtgggtccaggatggtgctctctggatcttg
ccagccttgcaagaggacgctggcacctacctctgcactgtcagaaacacgtcttactgt
gatgaaatgtccactgagctcagggtttttgagaagacagaagcttccctgcctttcata
tcatacccgcaaattcttacgttgtcaacctctgggtccttagtttgccctgagctgagt
gaattcatccgtaacaaaatggacatgaagattcagtggtacaaggattctgtccttttg
gatcaagacaatgagaagtttctaagtgtgaggggaacctctcgcttactcatacataat
gtgtctgtggaggatgcgggttattacagctgtgccatgacattcgcccacgaaggcatg
cagtacaacgtgactaggaatattgaactacgtgtcaacaaaaaagaagaggagacaatt
cctgtgattatctccccccaccagaccatcttagcttcactggggtcaagattgacaatt
ccatgtaaggtgtttctgggagctggcacacattcgaccaccatgctgtggtggatggcc
aacaccaccagcatagagagcgcgtaccagggaggccgtgtgaccgaggggcagcgccag
gaatactcggaaaataacgagaactacattgaagtgccactgatttttgatccagtcata
agagaggatttgaacacggattttaaatgcgttgtgcgcaacacactgagtactcagatg
ctacgtaccacggtcaaagaagctgccacattctcctgggggattgcgctggcccccctc
tccctggtcttcttggttttggtgggaatatggatgcacagacggtataaacacagaact
ggaaaaacatatggtttgaccacgttaaagactggcccttaa

DBGET integrated database retrieval system