KEGG   Felis catus (domestic cat): 101080765
Entry
101080765         CDS       T02385                                 
Symbol
PDHA1
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00020  Citrate cycle (TCA cycle)
fca00620  Pyruvate metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04066  HIF-1 signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
fca05415  Diabetic cardiomyopathy
Module
fca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101080765 (PDHA1)
   00020 Citrate cycle (TCA cycle)
    101080765 (PDHA1)
   00620 Pyruvate metabolism
    101080765 (PDHA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101080765 (PDHA1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101080765 (PDHA1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101080765 (PDHA1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101080765 (PDHA1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     101080765 (PDHA1)
SSDB
Motif
Pfam: E1_dh DXP_synthase_N TPP_enzyme_C
Other DBs
NCBI-GeneID: 101080765
NCBI-ProteinID: XP_004001586
Ensembl: ENSFCAG00000012903
LinkDB
Position
X:15796823..15813203
AA seq 390 aa
MRKMLAAVSRVLSGVAQKPASRVLVASRNFANDATFEIKKCDLHRLEEGPPVTTVLTRED
GLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRA
HGFTFTRGLSVREILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALA
CKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAAST
DYYKRGDFIPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPGVS
YRTREEIQEVRSKSDPIMLLKDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPP
LEELGYHIYSSDPPFEVRGANQWIKFKSIS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaggaaaatgctcgcagctgtctcccgcgtgttgtcgggcgtcgcccagaagccggca
agcagagtgctggtggcatcccgtaattttgcaaatgatgctacatttgaaattaagaaa
tgtgatcttcaccgactggaagagggccctcctgtcaccacggtactcaccagggaggat
gggctcaaatactataggatgatgcagactgttcgccgaatggaattaaaggcagatcag
ctgtataaacagaaaattattcgtggtttttgtcacttgtgtgatggtcaggaagcttgt
tgtgtgggcctggaggccggcataaatcccacagaccatcttatcacagcctatcgggct
catggcttcacctttactcgtggactttctgtccgagaaattcttgcagagcttacagga
cgaagaggaggttgcgctaaagggaaaggcggatcgatgcatatgtatgccaaaaacttc
tacgggggcaacggcatcgttggagctcaggtgcccctgggagcagggattgctctggcc
tgtaagtataacggaaaggatgaggtctgtttgactttatatggcgatggtgctgctaac
caaggtcagatattcgaagcttacaatatggcagctttgtggaaattgccatgtattttc
atctgtgaaaataaccgctatggaatgggaacatccgttgagagagcagcggccagcacg
gattactacaagagaggtgacttcattcctgggctgagggtagatggaatggatatcctg
tgtgtccgggaggcgacgaggtttgcagccgcctactgtagatctggaaaggggcccata
ctgatggagctacagacttaccgctaccacggacatagcatgagtgaccctggtgtcagt
taccgtacacgagaggagattcaggaagtaagaagtaagagtgaccctattatgcttctc
aaggatagaatggtgaacagcaacctggccagtgttgaggaattaaaggaaattgatgtt
gaagtgaggaaagagattgaggatgctgcccagtttgccaccgctgatcctgaaccgcct
ttggaagaactaggctatcacatttacagcagcgacccaccttttgaagttcggggtgca
aatcagtggatcaagtttaagtccatcagttaa

KEGG   Felis catus (domestic cat): 101081627
Entry
101081627         CDS       T02385                                 
Symbol
PDHA2
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00020  Citrate cycle (TCA cycle)
fca00620  Pyruvate metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04066  HIF-1 signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
fca05415  Diabetic cardiomyopathy
Module
fca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101081627 (PDHA2)
   00020 Citrate cycle (TCA cycle)
    101081627 (PDHA2)
   00620 Pyruvate metabolism
    101081627 (PDHA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101081627 (PDHA2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101081627 (PDHA2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101081627 (PDHA2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101081627 (PDHA2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     101081627 (PDHA2)
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 101081627
NCBI-ProteinID: XP_011280095
UniProt: M3W8H3
LinkDB
Position
B1:complement(127706708..127708162)
AA seq 391 aa
MRKMLAAAVSRVLSGITQKPASRVLVVSCNYSNDAMFAIKKCDLYRLEEGPPVTTVLTRE
DGLKYYRMMQTVRRMELKADQLYKQKFIRGFCHLCDGQEACSVGLEAGINPTDHVITSYR
AHGLYYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYVKNFYGGNGIVGAQGPLGAGIAL
ACKYKGNKEVCLALYGDGAANQGQIAEAHNMAALWKLPCVFICENNLYGMGTPVERASAS
TDYYKRGNFIPGLRVDGMDVLGVREATKFVADYCRSGKGPIVMELQTYRYHGHSMSDPGI
SYRTREEVQNVRRESDPIMLLKDRMVNSKLATVEELKDIDVEVRKEVEDAAQFAMTDPEP
PLEELAHHIYCNTPAFEVRGTNQWIKFKSLS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaggaagatgctcgctgccgctgtctcccgcgtgttgtccgggatcacgcagaagccc
gctagcagagtgctggtggtatcctgtaactattcaaatgatgcgatgtttgcaattaag
aaatgtgatctttatcgcttagaagagggtccccctgtcaccacagtgctcacccgggag
gatgggctcaaatactacaggatgatgcagactgttcgccgaatggagctgaaggcagat
cagctgtataaacaaaagtttatccgtggcttctgtcacttgtgcgatggtcaagaagct
tgttctgtgggcctggaggccgggataaatcccaccgaccatgtcatcacatcctatcgg
gctcatggcttgtactatactcgtggactctctgtccgatcaattcttgcagagctgaca
ggacgaaggggaggctgtgctaaaggaaaaggaggatcgatgcatatgtatgtcaagaat
ttctatgggggcaatggcattgttggcgcacaggggcccctgggagctggtattgctctg
gcctgtaaatacaagggaaacaaggaggtctgtttggctctttatggggatggtgctgcg
aatcagggtcagatagccgaagctcacaatatggcagctttgtggaaattaccctgtgtt
ttcatctgtgagaataacctctatggaatgggaacccctgttgagagagcatcagccagc
actgattactataagagaggaaattttatccctggactgagggtagacggaatggatgtt
ctaggtgttcgggaggcaactaagtttgtagctgactactgtagatctggaaaggggccc
atagtgatggagctgcagacctaccggtatcatgggcacagtatgagtgaccctgggatc
agttatcgtacccgagaagaagttcagaatgtgagaagggagagcgatcctattatgctt
ctcaaagacagaatggtaaacagtaagcttgccactgttgaggaactaaaggatattgat
gttgaagtgaggaaagaagttgaggatgcagcccagtttgctatgactgatcctgagcca
cctttggaagaattagctcatcacatctactgcaatactccagcttttgaagttcgtggt
acaaaccagtggatcaagttcaagtccctcagttaa

KEGG   Felis catus (domestic cat): 101100374
Entry
101100374         CDS       T02385                                 
Symbol
PDHB
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta, mitochondrial
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00020  Citrate cycle (TCA cycle)
fca00620  Pyruvate metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04066  HIF-1 signaling pathway
fca04922  Glucagon signaling pathway
fca05230  Central carbon metabolism in cancer
fca05415  Diabetic cardiomyopathy
Module
fca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101100374 (PDHB)
   00020 Citrate cycle (TCA cycle)
    101100374 (PDHB)
   00620 Pyruvate metabolism
    101100374 (PDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101100374 (PDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101100374 (PDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    101100374 (PDHB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101100374 (PDHB)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     101100374 (PDHB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 101100374
NCBI-ProteinID: XP_003982424
Ensembl: ENSFCAG00000002206
UniProt: M3VY34
LinkDB
Position
A2:complement(26352262..26358059)
AA seq 359 aa
MAAVSGLMRRPLEQVSGLLRRRFHRTAPAALQVTVREAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGFQSVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPSEAQSKDFLIPIGKAKIERQGTHITVV
SHSRPVGHCLEAATVLSKEGIECEVINMRTIRPMDIETIEASVMKTNHLITVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSVPQVKDIIFAIKKTLNI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcggtgtctgggctgatgcggagaccccttgaacaggtctccgggctgctgagg
aggcgcttccaccgaacggcgccggcggcgctgcaggtgacagttcgtgaagctataaac
caaggtatggatgaggagctggaaagagatgagaaggtgtttctgcttggggaagaagtt
gcccagtatgatggggcatataaggttagtcgaggcctgtggaagaaatacggagataag
aggatcatagacactcccatatctgagatgggctttgctggaattgccgtgggtgcggcc
atggctgggttgaggcccatttgtgaatttatgaccttcaatttctctatgcaagccatt
gaccaggttataaactcagctgccaagacctactacatgtcagggggctttcagtctgtg
cccatagtcttcagggggcccaatggcgcctcagcaggtgtggctgcccagcactcacag
tgctttgctgcctggtatgggcactgcccaggcttaaaggtggtcagcccctggaattca
gaggatgcaaaaggacttattaaatcagccattcgggataacaacccagtggtggtgcta
gagaatgaactgatgtatggagttccttttgaatttccctcagaagctcaatcaaaagat
tttctgattcccattggaaaagccaaaatagaaaggcaagggacacacataactgtagtt
tcccattcaagacccgtgggccactgcttagaagctgcaacggtgctatccaaagaagga
attgaatgtgaggtgataaatatgcgaaccatcagaccaatggacattgaaacaatagaa
gccagtgtcatgaagaccaatcatctcataactgtggaaggaggctggccacagtttgga
gtaggagctgaaatttgtgccaggatcatggaaggccctgcattcaatttcctggatgct
cctgcagttcgtgtcactggtgctgatgtccctatgccttatgcaaagattctagaagac
aactcggtacctcaggttaaagacatcatatttgcaataaagaaaacattaaatatctag

DBGET integrated database retrieval system