KEGG   Felis catus (domestic cat): 101080818
Entry
101080818         CDS       T02385                                 
Symbol
KCNJ6
Name
(RefSeq) G protein-activated inward rectifier potassium channel 2
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04929  GnRH secretion
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101080818 (KCNJ6)
   04915 Estrogen signaling pathway
    101080818 (KCNJ6)
   04921 Oxytocin signaling pathway
    101080818 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    101080818 (KCNJ6)
   04725 Cholinergic synapse
    101080818 (KCNJ6)
   04728 Dopaminergic synapse
    101080818 (KCNJ6)
   04726 Serotonergic synapse
    101080818 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    101080818 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101080818 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101080818 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101080818 (KCNJ6)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   101080818 (KCNJ6)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 101080818
NCBI-ProteinID: XP_003991483
Ensembl: ENSFCAG00000005152
LinkDB
Position
C2:7715780..7984936
AA seq 423 aa
MARLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYVTSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPSLSAKELAELASRAELPLSWSVSSKLNQRADPETEEEEKNLEEQTERNGDVANLENE
SRV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccaggttgacagaatccatgactaacgtcctggagggcgactccatggaccaggat
gttgagagccctgtggccattcaccagccaaagttgcctaagcaggccagggacgacctg
ccaagacacatcagccgagaccggaccaaaaggaaaatccagaggtacgtgcggaaagat
ggaaagtgcaacgtccatcatggcaacgtgagggagacctatcgctacctgactgacatc
ttcaccaccttagtggatctcaagtggagattcaacctgttgatcttcgtcatggtttac
acagtgacttggctcttttttgggatgatctggtggctaatcgcatacatccgaggagat
atggaccacatagaggacccctcgtggactccctgtgtcaccaacctcaacgggttcgtc
tctgcttttttattttcgatagagacagaaaccaccatcggttatggctaccgggtcatc
acagacaagtgcccagagggaattattctcctcttaattcaatctgtgctggggtccatc
gtcaatgcattcatggtgggatgcatgtttgtaaaaatatcacaacccaagaagagggca
gagaccctggttttttccacccatgcggtgatctccatgcgggatggaaaactgtgcctg
atgttccgagtaggggatcttaggaattcccacatcgtagaggcttccatccgagccaag
ttgatcaaatccaaacagacctcagagggtgagttcatccccttgaaccaaacagatatc
aatgtagggtattacaccggggatgaccgtctatttctggtgtcgccactcatcatcagc
cacgaaatcaaccaacagagtcctttctgggagatctccaaagcccagctgcccaaagag
gagctagaaattgtggtcatcctagaaggaatggtggaggctacaggaatgacgtgccaa
gcccggagctcctacgtcaccagtgagatcctgtggggctaccgcttcacacctgtcctg
acgctggaagacggcttctatgaggtcgactataacagcttccacgagacctacgagacc
agcaccccgtctctcagtgccaaagagctggccgagctggccagccgggcggagctgccc
ctgagttggtccgtgtccagcaaactcaaccagcgcgcggacccggagacggaagaggag
gagaagaacctcgaggagcaaacagaaaggaatggtgacgtggcaaacctagaaaacgaa
tccagagtctag

KEGG   Felis catus (domestic cat): 101088179
Entry
101088179         CDS       T02385                                 
Symbol
KCNJ3
Name
(RefSeq) G protein-activated inward rectifier potassium channel 1 isoform X1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04929  GnRH secretion
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101088179 (KCNJ3)
   04915 Estrogen signaling pathway
    101088179 (KCNJ3)
   04921 Oxytocin signaling pathway
    101088179 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101088179 (KCNJ3)
   04725 Cholinergic synapse
    101088179 (KCNJ3)
   04728 Dopaminergic synapse
    101088179 (KCNJ3)
   04726 Serotonergic synapse
    101088179 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    101088179 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088179 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101088179 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101088179 (KCNJ3)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   101088179 (KCNJ3)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 101088179
NCBI-ProteinID: XP_003990827
Ensembl: ENSFCAG00000029250
UniProt: M3XFS7
LinkDB
Position
C1:147372342..147528353
AA seq 501 aa
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQSEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDMTTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattaccaggtagtgaccacctcgtccagc
gggtcgggcttgcagccccaggggccgggccagggcccgcagcagcagcttgtgcccaag
aagaagcggcagcggttcgtggacaagaacggccggtgcaatgtgcagcacggcaacctg
ggcagcgagacgagccgctacctctcggacctcttcaccaccctggtggacctcaagtgg
cgctggaacctcttcatcttcatcctcacctacaccgtggcctggctcttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggcaactac
acgccctgcgtggccaatgtctacaacttcccctccgccttcctcttcttcatcgagacc
gaggctaccatcggctatggctaccgctacatcaccgacaagtgccccgagggcatcatc
ctcttcctcttccagtccattctgggctccatcgtggacgccttcctcatcggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgcggagaccctgatgtttagcgagcacgcg
gtgatctccatgagggacggaaaactcacgctcatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagatccgctgtaagctgctcaaatctcggcagacacctgag
ggtgagttccttccccttgaccaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtttcccccctcacaatttgccacgtgatcgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaagtgaacagttcgagattgtcgtcatcctagaa
ggcattgtggaaacaactgggatgacttgtcaagctcgaacatcttacactgaagatgaa
gttctttggggccatcgtttttttcctgtgatatccttagaagaagggttctttaaagtt
gattactcccagtttcacgcaacatttgaagtccccacgccaccttatagcgtgaaagaa
caggaggaaatgctgcttatgtcgtcccctttgatagcaccagccattactaacagcaaa
gaaagacacaattctgtggaatgcttagatggactcgacgacatgactacaaagcttccg
tctaagctgcagaaaattactggaagagaagactttcccaaaaaactcttgaggatgagt
tctacaacttcagaaaaagcctacagcttgggagatttgcccatgaaacttcaacgaata
agttcagttcctggcaactcagaagaaaaactggtatctaaaacaaccaagatgttgtct
gatcccatgagccagtcagtggctgatttgccaccaaagcttcaaaaaatggcgggagga
gcagccaggatggaagggaatctcccagccaaattaagaaaaatgaactctgatcgattc
acataa

KEGG   Felis catus (domestic cat): 101091342
Entry
101091342         CDS       T02385                                 
Symbol
KCNJ9
Name
(RefSeq) G protein-activated inward rectifier potassium channel 3
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04929  GnRH secretion
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101091342 (KCNJ9)
   04915 Estrogen signaling pathway
    101091342 (KCNJ9)
   04921 Oxytocin signaling pathway
    101091342 (KCNJ9)
  09156 Nervous system
   04728 Dopaminergic synapse
    101091342 (KCNJ9)
   04726 Serotonergic synapse
    101091342 (KCNJ9)
   04723 Retrograde endocannabinoid signaling
    101091342 (KCNJ9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101091342 (KCNJ9)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101091342 (KCNJ9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101091342 (KCNJ9)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   101091342 (KCNJ9)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 101091342
NCBI-ProteinID: XP_019676929
LinkDB
Position
F1:complement(66872266..66877229)
AA seq 392 aa
MARAGAPRSPGPEPPRRRGRQRYVEKDGRCNVQQGNVREPGRYLTDLFTTLADLQWRLSL
LFFVLAYALTWLFFGAIWWLVAYGRGDLEHLGDAAWTPCVNNLNGFVAAFLFSIETETTI
GYGHRVITDQCPEGIALLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSL
RDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFL
VSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWG
HRFTSVLTLEDGFYEVDYASFHQTFEVPTPSCSARELAEAAARLDAHLYWSVPSRLDEKV
EEEGAGEGAGGGAGADKEQNGCLPPPESESKV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcgcgggccggcgccccccgctccccgggccccgagccgccgcgccgccgcggccgc
cagcgctacgtggagaaggacggcaggtgcaacgtgcagcagggcaacgtgcgcgagccg
ggccgctacctgaccgacctgttcaccacgctggccgacctgcagtggcgcctgagcctg
ctcttcttcgtgctcgcctacgcgctcacctggctcttcttcggcgccatctggtggctg
gtggcctacggccgcggcgacctggagcacctgggcgacgcggcgtggacgccgtgcgtc
aacaacctcaacggcttcgtggccgccttcctgttctccatcgagacggagaccaccatc
ggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgcgctgctgctgctg
caggccatcctgggctccatggtgaacgccttcatggtgggctgcatgttcgtcaagatc
tcgcagcccaacaagcgcgccgccacgctcgtcttctcgtcgcacgccgtggtgtcgctg
cgcgacgggcgcctgtgcctcatgttccgcgtgggcgacctgcgctcgtcgcacatcgtc
gaggcctccatccgcgccaagctcatccgctcgcgccagacgctggagggcgagttcatc
ccgctgcaccagaccgacctgagcgtgggcttcgacacgggcgacgaccgcctcttcctc
gtgtcgccgctcgtcatcagccacgagatcgacgccgccagccccttctgggaggcgtcg
cgccgcgccctggagagggacgacttcgagatcgtcgtcatcctcgagggcatggtggag
gccaccggaatgacctgccaagctcggagctcctacctggtggacgaggtgctgtggggc
caccggttcacgtcggtgctcacgctggaggacggcttctacgaggtggactatgccagc
ttccaccagaccttcgaggtgcccacaccctcgtgcagcgcccgggagctggccgaggcc
gccgcccgcctagacgcccatctttactggtccgtccccagccggctggatgagaaggtg
gaggaggagggggccggggagggcgcgggcggaggggccggcgcggacaaggagcagaac
ggctgcctaccgcccccggagagcgagtccaaggtgtga

KEGG   Felis catus (domestic cat): 101091726
Entry
101091726         CDS       T02385                                 
Symbol
KCNJ5
Name
(RefSeq) G protein-activated inward rectifier potassium channel 4
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04929  GnRH secretion
fca05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101091726 (KCNJ5)
   04915 Estrogen signaling pathway
    101091726 (KCNJ5)
   04921 Oxytocin signaling pathway
    101091726 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    101091726 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    101091726 (KCNJ5)
   04726 Serotonergic synapse
    101091726 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    101091726 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101091726 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101091726 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101091726 (KCNJ5)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   101091726 (KCNJ5)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 101091726
NCBI-ProteinID: XP_006936854
Ensembl: ENSFCAG00000027850
UniProt: A0A2I2UE47
LinkDB
Position
D1:25853359..25882749
AA seq 419 aa
MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYIRGDLDH
VGDQDWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLDQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMRREGRLLQYLPSPPLPGGCAETELDTEAEQEGEDGPEGLGGSRENTGSV
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggctggcgattctaggaatgctatgaaccaggatatggagattggagtcactcccagg
gaccctaagaagattcccaaacaggcccgggattacatccccattgccacagaccgcacc
cgtctgctggcagaaggcaagaagccccgccagcgctacatggaaaagagtggcaagtgc
aacgtccaccatggcaacgtccaagaaacctatcggtacctgagcgacctcttcaccacc
ctggtggacctcaaatggcgcttcaacctgcttgtcttcacgatggtctacaccatcact
tggctgttcttcggtttcatttggtggctgattgcctatatccgaggtgatctggaccac
gttggtgaccaagattggattccttgtgttgaaaacctcagtggctttgtgtctgccttc
ctgttctccattgagactgaaaccaccatcgggtatggctttcgggtgatcacagagaag
tgtccagaggggatcatactcctcttggtccaggccatccttggctccatcgtcaatgca
ttcatggtggggtgcatgtttgtcaagatcagtcagccaaagaagagagcagagaccctc
atgttttccaacaacgcggtcatctccatgcgggacgagaagctctgcctcatgttccgg
gtgggtgaccttcgcaactcccacattgtggaggcctccatccgcgccaaactcatcaaa
tcccggcagaccaaagaaggggagttcatccccctgaaccagacggacattaacgtgggc
ttcgacactggggatgaccgtctcttcctggtgtctccgctcatcatctcccacgagata
aatgagaagagccccttctgggagatgtctcgggcccagctggatcaggaggagtttgaa
gtcgtggtcattctagaagggatggtggaggcaacaggtatgacttgccaggcacggagc
tcctacatggatacagaggtgctctggggccaccgattcacaccagtcctcaccttggaa
aagggcttctacgaggtggactacaacaccttccatgacacctacgagaccaacacgccc
agctgctgtgccaaggagctggcagaaatgaggcgggaaggccggctcctccagtatctc
cctagcccacccctgccggggggctgtgctgaaacggagctcgatacagaggccgagcag
gagggagaggatgggcccgagggcctgggtgggtcccgggagaacacgggttcggtgtga

DBGET integrated database retrieval system