KEGG   Felis catus (domestic cat): 101081104
Entry
101081104         CDS       T02385                                 
Symbol
CORO1A
Name
(RefSeq) coronin-1A
  KO
K13882  coronin-1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101081104 (CORO1A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101081104 (CORO1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081104 (CORO1A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101081104 (CORO1A)
   04147 Exosome [BR:fca04147]
    101081104 (CORO1A)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Coronins
    101081104 (CORO1A)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101081104 (CORO1A)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101081104 (CORO1A)
SSDB
Motif
Pfam: Trimer_CC DUF1899 WD40_4 WD40 ANAPC4_WD40 NBCH_WD40 CENP-Q Wtap Vps51 DivIC FlaC_arch DUF2730 Prefoldin_2 DUF3138 bZIP_1
Other DBs
NCBI-GeneID: 101081104
NCBI-ProteinID: XP_023102423
Ensembl: ENSFCAG00000001301
LinkDB
Position
E3:21534863..21540433
AA seq 461 aa
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
VLSLGKTGRVDKNAPMVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLTLPL
REPVVTLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGSDVHPDTIY
SVDWSRDGALICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSDGKILTTGFS
RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
APYLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
EDLYPPTAGPDAALTAEEWLKGQDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRKAAPE
AGGTPSSDAIHRLEEEMKKLQATVQELQKRLESLEETVQAK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccagccaag
gccgaccagtgctatgaggacgtgcgcgtctcccagaccacctgggacagtggcttttgt
gctgtcaaccccaagttcgttgccctgatctgtgaggccagcgggggaggggccttcctg
gtgctgtccctgggcaagactggacgtgtggacaagaacgcgcccatggtctgcggccac
acagccccggtgctggacatcgcctggtgcccgcacaatgataatgtcattgccagtggc
tctgaggattgcacagtcatggtgtgggagatccctgatgggggcctgacgctgcccctg
agggagcctgtcgtcaccctggagggccacaccaagcgcgtgggcatcgtggcctggcac
cccacagcccagaatgtgctgctcagtgcaggttgcgacaacgtgatcctggtgtgggac
gtgggcaccggggcggctgtgctgacgctcggctcggacgtgcacccggacacaatctac
agtgtggactggagccgagatggcgcgctcatttgcacctcctgccgcgacaagcgcgtg
cgcatcatcgagccccgcaaaggcactgttgtagctgagaaggaccgtccccatgagggg
acccggcctgtgcgcgccgtgtttgtatctgatgggaagatcctgaccacaggcttcagc
cgcatgagtgagcggcaggtggcgctgtgggacacgaaacacctggaggagccactgtcc
ctgcaggaactggacacgagcagtggcgtcctgctgcccttctttgaccccgacaccaac
atagtctacctctgtggcaagggtgacagctccatccggtacttcgagatcacttccgag
gccccatatctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggc
tacatgcccaaacgcggcctggaggtgaacaagtgtgagattgccagattctacaagctg
cacgagcggaggtgtgagcccattgccatgacagtgcctagaaagtcggacctgttccag
gaggacctttacccacccaccgcggggcctgacgctgccctcacggctgaggagtggctg
aagggccaggatgccgggcccctcctcatttccctcaaggatggctatgtgcccccaaag
agccgggagctgagggtcaaccggggcctggacaccgggcgcagaaaggcagcaccagag
gccggtggtacccccagctcggacgccatacaccggctggaggaggaaatgaagaagctc
caggccacagtgcaggagctacagaagcgcttggagagtctggaggagacagtccaggcc
aagtag

DBGET integrated database retrieval system