KEGG   Felis catus (domestic cat): 101081169
Entry
101081169         CDS       T02385                                 
Symbol
FZD10
Name
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101081169 (FZD10)
   04390 Hippo signaling pathway
    101081169 (FZD10)
   04150 mTOR signaling pathway
    101081169 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101081169 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101081169 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081169 (FZD10)
   05205 Proteoglycans in cancer
    101081169 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101081169 (FZD10)
   05226 Gastric cancer
    101081169 (FZD10)
   05217 Basal cell carcinoma
    101081169 (FZD10)
   05224 Breast cancer
    101081169 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101081169 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081169 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    101081169 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101081169 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101081169 (FZD10)
   04090 CD molecules [BR:fca04090]
    101081169 (FZD10)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101081169 (FZD10)
CD molecules [BR:fca04090]
 Proteins
  101081169 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 101081169
NCBI-ProteinID: XP_023097038
LinkDB
Position
D3:complement(2302793..2304633)
AA seq 581 aa
MPRPGPRLWLVLQVMGSCAAISSMDTERPGDGKCQAIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSRLPNKNDPNYLCMEAPNNGSDEPSRGSGLFPPLFRPQRPHSAQEH
PLRDAGPGRASCDNPGKFHHVEKSAACAPLCAPGVDVYWSRGDKRFAVVWLAVWAVLCFF
SSAFTVLTFLVDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVVGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMEYWKVLATQHT
CKTNNQTKSLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRFK
TKSRRKPASVITNSGIYKKGQHPQKTHLGKYEIPDQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccgcggccgggcccccgcctgtggctggtcctgcaggtgatgggttcgtgcgccgcc
atcagctccatggacacggagcgcccgggcgacggcaagtgccaggccatcgagatcccg
atgtgcaaggacatcggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaggctccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagccctcccgg
ggctccggcctgttcccgccgctcttccggccgcagcggccgcacagcgcgcaggagcac
ccgctccgggacgcgggcccggggcgcgccagctgtgacaacccgggcaagttccaccac
gtggagaagagcgccgcgtgcgcgccgctgtgcgcgcccggcgtggacgtgtactggagc
cgcggcgacaagcgcttcgccgtggtctggctggccgtgtgggccgtgctgtgcttcttc
tctagcgccttcaccgtgctcaccttcctcgtcgacccggcgcgcttccggtaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctctttgccggcgccgagagcatcgcctgcgaccgcgacagcggacagctctacgtcatc
caggaggggctggagagcaccggctgcaccctcgtcttcctggtcctctactacttcggg
atggccagctcgctgtggtgggtgattctcacgctcacctggttcctggcggccggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcggcctgggcc
atcccggccgtgaagaccatcctgatcctggtgatgcgccgggtggcgggggacgagctc
accggcgtgtgctacgtgggcagcatggacgtgaacgccctcaccggcttcgtgctcatc
ccgctggcctgctacctcgtggtgggcacttccttcattctgtccggcttcgtggcactc
ttccacatcaggagggtgatgaagaccggcggggagaacacggacaaactggagaagctc
atggtgagaatcggggtcttctcggtgctctacacggtgccggccacctgtgtgatcgcc
tgttacttctacgagcgcctcaacatggagtactggaaggtcctggccacccagcacacg
tgcaaaacaaacaaccagaccaagagtctggactgtctgatggccgcctccatccccgcc
gtggagatcttcatggtgaagattttcatgctgctggtggtgggtatcaccagcggcatg
tggatctggacgtccaagaccctgcagtcctggcagaacgtttgcagccgcaggttcaag
acaaagagcaggaggaaaccggccagcgtgatcaccaacagtgggatttacaaaaaaggc
cagcatccccaaaagacgcatctggggaaatacgaaatccctgaccagcctcccacctgt
gtgtga

KEGG   Felis catus (domestic cat): 101082735
Entry
101082735         CDS       T02385                                 
Symbol
FZD1
Name
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101082735 (FZD1)
   04390 Hippo signaling pathway
    101082735 (FZD1)
   04150 mTOR signaling pathway
    101082735 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101082735 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101082735 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082735 (FZD1)
   05205 Proteoglycans in cancer
    101082735 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101082735 (FZD1)
   05226 Gastric cancer
    101082735 (FZD1)
   05217 Basal cell carcinoma
    101082735 (FZD1)
   05224 Breast cancer
    101082735 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101082735 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082735 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    101082735 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101082735 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101082735 (FZD1)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101082735 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 101082735
NCBI-ProteinID: XP_003982789
Ensembl: ENSFCAG00000027318
UniProt: M3X4M3
LinkDB
Position
A2:96561262..96570791
AA seq 652 aa
MAEEEAPKKSWAAAAGGGASWELYAGALPAGPVAEGSGDAESHRRRPPADSGRLARRLLL
LLWLLEVPLLLGVRAQAVGQGPGQGPGPGQQPPPPPPQQQQGGQQYNGERGISIPDHGYC
QPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPV
CTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKG
TPTPSLLPEFWTSNPQHGGGGHRGGGFPGGSGASERGKFSCPRALKVPSYLNYHFLGEKD
CGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPI
IFLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMA
SSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSG
VCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMV
RIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPP
MSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggctgaagaggaggcgcctaagaagtcctgggccgccgccgccggcggcggcgcgagc
tgggaactttatgccggggcgctcccagctggaccggtggcggaagggagcggagatgcc
gagagccaccgccgccgccccccagctgactccgggcgcttggcgcgccggctcctgcta
ctgctttggctgctggaggttccgctgctgctgggggtccgggcgcaggcagtgggccag
gggccgggccaggggcccgggccggggcagcagcccccaccgccgccgcctcagcagcag
cagggcgggcaacagtacaacggcgagcggggcatctctatcccggaccacggctactgc
cagcccatctccatcccgctgtgcacagacatcgcgtacaaccaaaccatcatgcccaac
cttttgggccacacgaaccaagaggatgcgggcctcgaggtgcaccaattctaccccttg
gtgaaggtgcagtgctcggcggaactcaagttcttcttgtgctctatgtacgcgccagtg
tgcacggtgctggagcaggctctgccgccctgccgctccctgtgcgagcgtgcgcgccag
ggctgcgaggcgctcatgaacaagttcggcttccagtggcctgacacgctcaagtgtgag
aagttcccggtgcacggcgccggcgagctgtgcgtgggccaaaatacgtcggacaagggc
accccgacgccctcgttgctcccggagttctggaccagcaaccctcagcacggcggcggg
gggcaccgtggcggcggcttcccggggggctccggcgcgtcggagcgtggcaagttctct
tgcccgcgcgccctcaaggtgccctcctacctcaactaccacttcctaggggagaaggac
tgcggtgcgccctgtgagccgaccaaggtgtacgggcttatgtactttgggcccgaggag
ctgcgcttctcgcgcacctggatcggcatctggtcggtgctgtgctgcgcctccacgctt
ttcacggtgctaacgtacctggtggacatgcggcgcttcagctacccggagcggcccatc
atcttcctgtccggctgctacacggcagtggccgtggcctacatcgccggcttcctgctg
gaggaccgagtggtgtgtaatgacaagttctccgaggacggggcacgcacagtggcgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctttacttcttcagcatggcc
agctccatctggtgggtgatcctgtcgctcacctggttcctggcagcgggcatgaagtgg
ggtcacgaagccatcgaggctaactcgcaatattttcacctggccgcctgggccgttccg
gccatcaagaccatcaccatcctggcgctgggccaggtggacggcgatgtgctgagcggg
gtgtgcttcgtagggctcaacaatgtggacgcgctgcgcggcttcgtgctggcgccactc
ttcgtgtacctgttcatcggcacgtcttttttgttggccggcttcgtgtccctcttccgc
attcgcaccatcatgaagcacgacggcaccaagaccgagaagctggagaagctcatggtg
cgcatcggcgttttcagcgtgctttacacggtgccagccactattgtcatcgcctgctac
ttctatgagcaggccttccgggaccagtgggagcgcagctgggtggcccagagctgcaag
agctacgccatcccctgcccccacctccaggcgggtggaggcgccccgccgcacccgccc
atgagcccagacttcacagtcttcatgatcaagtaccttatgacgctgatcgtgggcatc
acgtcaggcttctggatctggtccggcaagaccctcaactcctggaggaagttctatacc
aggctcaccaacagcaaacagggggagaccaccgtctga

KEGG   Felis catus (domestic cat): 101085253
Entry
101085253         CDS       T02385                                 
Symbol
FZD2
Name
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101085253 (FZD2)
   04390 Hippo signaling pathway
    101085253 (FZD2)
   04150 mTOR signaling pathway
    101085253 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101085253 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101085253 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085253 (FZD2)
   05205 Proteoglycans in cancer
    101085253 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101085253 (FZD2)
   05226 Gastric cancer
    101085253 (FZD2)
   05217 Basal cell carcinoma
    101085253 (FZD2)
   05224 Breast cancer
    101085253 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101085253 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085253 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    101085253 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101085253 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101085253 (FZD2)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101085253 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 101085253
NCBI-ProteinID: XP_011287572
LinkDB
Position
E1:44576113..44578040
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccagaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccatacgaaccaggaggacgcgggcctggaggtgcaccagttctacccgttggtg
aaggtgcagtgctcccccgaactgcgcttcttcttgtgctccatgtacgcacccgtgtgc
accgtgctggagcaggccatcccgccgtgccgctccatctgcgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcggtttccagtggcccgagcgcctgcgctgcgagcac
tttccgcgccacggcgcggagcagatctgcgtgggccaaaaccactccgaagacggcacg
cccgcgctgctcactaccgcgcctccgcccggcctgcagccgggtgccgggggcaccccg
ggcggcccgggcggcggcggctcgcccccgcgctacgccacgctggagcaccctttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgcgac
tgcgcggcgccctgtgagccggcgcggcccgacggctccatgttcttctctcaggaggag
acgcgcttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcaccgtcactacctacctggtagacatgcagcgcttccgctacccggagcgacccatc
atctttctgtccggctgctacactatggtttcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtcgtgtgtaacgagcgcttttccgaggacggctaccgcacagtggtgcag
ggcaccaagaaggagggctgcaccatcctctttatgatgctgtacttcttcagtatggcc
agttccatctggtgggtcatcctgtctctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcccagtacttccacctggccgcgtgggccgtgccg
gcggtcaagaccatcactatcctggccatgggccagattgacggcgacctgctgagcggc
gtgtgtttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtcctttctcctggctggtttcgtgtcactcttccgc
atccgtaccatcatgaagcacgacggcaccaagacggagaagctggagcggctcatggtg
cgcatcggcgtcttctcggtgctctacaccgtgcctgctaccatcgtcatcgcctgctac
ttctacgagcaggcctttcgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcacccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacccgtctcaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Felis catus (domestic cat): 101087255
Entry
101087255         CDS       T02385                                 
Symbol
FZD7
Name
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101087255 (FZD7)
   04390 Hippo signaling pathway
    101087255 (FZD7)
   04150 mTOR signaling pathway
    101087255 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101087255 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101087255 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087255 (FZD7)
   05205 Proteoglycans in cancer
    101087255 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101087255 (FZD7)
   05226 Gastric cancer
    101087255 (FZD7)
   05217 Basal cell carcinoma
    101087255 (FZD7)
   05224 Breast cancer
    101087255 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101087255 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087255 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    101087255 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101087255 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101087255 (FZD7)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101087255 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 101087255
NCBI-ProteinID: XP_019694698
LinkDB
Position
C1:188981135..189005255
AA seq 602 aa
MRGPGAAASRLPLGLCTLVLALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSEDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAACNICQQDNWISKRGKGPITGDFIAET
GW
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgcggccgcgtcgcgcttgcccctgggcctgtgcactctagtgctt
gcgctgctaggcgcgctgcccgccggtgccggggcgcagccttaccacggcgagaagggc
atctcggtaccggaccacggcttctgccagcccatctccatcccactatgcacggacatt
gcctacaaccagaccatcctgcccaacctgctaggccacacgaatcaagaggacgcgggc
ctcgaggtacaccagttctacccgctggttaaggtgcagtgttctcccgagttgcgcttc
ttcctgtgctctatgtacgcacccgtgtgcacggtgcttgatcaggccatcccgccgtgc
cgttctctgtgcgagcgtgcccgccagggctgcgaagcgctcatgaacaagttcggcttc
cagtggccagagcggctgcgctgcgagaacttcccggtgcacggcgccggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggtggcggccccacagcctacccc
accgcgccctacatgccggacttgcccttcaccgcgctgcccccgggggccgctgatggc
aggggccgttctgccttccccttctcgtgcccccgccagctcaaggtgcccccctacctg
ggctaccgcttcctgggcgagcgcgactgcggcgccccgtgcgagccgggccgtgccaac
ggcctaatgtattttaaggaagaggagaggcgctttgcccgtctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctcttcaccgtgctcacctatttagtggacatgagg
cgcttcagctatcccgagcggcccatcatctttctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttcctgctggaggaccgcgcggtgtgcgtggagcgcttctca
gaagacggctaccgcacggtggcgcagggcaccaagaaggagggttgcactatcctcttc
atggtgctgtacttcttcggcatggccagttccatctggtgggtcatcctgtcgctcact
tggttcctggcagctggcatgaagtggggccatgaggccattgaagccaactctcagtat
ttccacctggccgcgtgggccgtgcccgctgtcaagaccatcaccatcttggccatgggc
caggtggatggggacttgctcagtggggtttgctacgtgggcctgtccagcgtggatgcg
ctgcgaggcttcgtgttggcgcctctgttcgtctacctcttcattggcacgtccttcctg
ctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaagcacgacggaaccaag
accgagaaactggagaagctcatggtgcgcatcggcgtcttcagcgtgctttacactgtg
ccggcgaccatcgtcctggcctgctacttctatgagcaggccttccgcgaacactgggag
cgcacctggctcctgcagacttgcaagagctacgcggtgccctgcccgcctggccatttc
ccgcccatgagccctgacttcactgtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtccggcaagactctgcagtcgtggcgccgcttc
tatcacagactcagccacagcagcaagggggagactgcggcttgcaacatttgccagcaa
gataactggatttccaaaagagggaagggtccaatcacaggagacttcatagcagaaaca
ggctggtga

KEGG   Felis catus (domestic cat): 101087697
Entry
101087697         CDS       T02385                                 
Symbol
FZD9
Name
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101087697 (FZD9)
   04390 Hippo signaling pathway
    101087697 (FZD9)
   04150 mTOR signaling pathway
    101087697 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101087697 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101087697 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087697 (FZD9)
   05205 Proteoglycans in cancer
    101087697 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101087697 (FZD9)
   05226 Gastric cancer
    101087697 (FZD9)
   05217 Basal cell carcinoma
    101087697 (FZD9)
   05224 Breast cancer
    101087697 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101087697 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087697 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    101087697 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101087697 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101087697 (FZD9)
   04090 CD molecules [BR:fca04090]
    101087697 (FZD9)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101087697 (FZD9)
CD molecules [BR:fca04090]
 Proteins
  101087697 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 101087697
NCBI-ProteinID: XP_003998602
Ensembl: ENSFCAG00000012671
LinkDB
Position
E3:10085399..10087563
AA seq 591 aa
MAVPPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDPASGPGGGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCLAATMPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtgccgccgctccgccgggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcgctggagatcggccgtttcgatccggagcgcggtcgcgggccggcgccctgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggtgaggcggccgccgagctggccgagttcgcgccgctcgtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgttgtacgcgcccatgtgc
acggaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaacttcggctggccggactcgctggactgcgcc
cggctgcccacgcgcaacgacccgcacgcgctctgcatggaggcgcccgagaacgccacg
gccggccctgcggagccccacaagggcctgggcatgctgcccgtggcgccccggcccgcg
aggccccccggcgaccccgcctcaggcccgggcggcggcggcacctgcgagaacccagag
aagttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcgggcccggcgtcgag
gtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtcggcg
ctgtgcttcttctccacggccttcaccgtgctcaccttcctgctggagccccaccgcttc
cagtaccccgagcgccccatcatcttcctgtccatgtgctacaacgtctactcgctggcc
ttcctcatccgcgcggtggccggcgcccagagcgtggcgtgcgaccaggaggcaggagca
ctgtacgtgatccaggaggggctggagaacacgggctgcacgctcgtcttcctgctgctc
tactacttcggcatggccagctcgctgtggtgggtggtgctgacactcacctggttcctg
gcagccggcaagaagtggggccacgaggccatcgaggcccatggcagctacttccacatg
gcggcctggggcctgccggccctcaagaccatcgttatcctgaccttgcgcaaggtggcg
ggcgacgagctgaccgggctctgctacgtggccagcatggatgcggccgcgctgacgggc
tttgtgctggttcccctctcctgctacctggtgctgggcaccagcttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacaggcggcaccaacacggagaag
ctggagaagctcatggtcaagattggggtcttctccatcctctacacggtgcctgccacc
tgcgtcattgtgtgctatgtctatgaacgcctcaacatggacttctggcgccttcgggcc
acagagcagccctgcctggcagccaccatgcccgggggccggagggactgctcactacaa
ggggggtcggtgcccaccgtggctgtctttatgctcaagatcttcatgtcgctggtggtg
ggcatcaccagcggtgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgccaccgcaagatggcagctggccgggcccgggcaaaggcctgccgggctcccgggggc
tacggccgtggcacccattgccactataaggcccccaccgtggtcttgcacatgactaag
acggacccttctctggagaaccccacgcacctctag

KEGG   Felis catus (domestic cat): 101093710
Entry
101093710         CDS       T02385                                 
Symbol
FZD4
Name
(RefSeq) frizzled-4 isoform X1
  KO
K02354  frizzled 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101093710 (FZD4)
   04390 Hippo signaling pathway
    101093710 (FZD4)
   04150 mTOR signaling pathway
    101093710 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101093710 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101093710 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101093710 (FZD4)
   05205 Proteoglycans in cancer
    101093710 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101093710 (FZD4)
   05226 Gastric cancer
    101093710 (FZD4)
   05217 Basal cell carcinoma
    101093710 (FZD4)
   05224 Breast cancer
    101093710 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101093710 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093710 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    101093710 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101093710 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101093710 (FZD4)
   04090 CD molecules [BR:fca04090]
    101093710 (FZD4)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101093710 (FZD4)
CD molecules [BR:fca04090]
 Proteins
  101093710 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 101093710
NCBI-ProteinID: XP_003992698
Ensembl: ENSFCAG00000011826
UniProt: A0A2I2UH80
LinkDB
Position
D1:47886408..47895406
AA seq 540 aa
MAWRGSVPSVLGAPGGVDLSLRRLLLLLLLLLLPGPARGFGDEEERRCDPIRISMCQNLG
YNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPC
GGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQP
GEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFT
VLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGL
KNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAV
KTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR
SNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNTAVE
MLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggcctggcggggctcagtgccgagcgtcctgggggcgcccgggggcgtcgatctcagt
ctgcggcggctgctgctgctgctgctgttgctgctgctcccggggccagcgcgaggcttc
ggggacgaagaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggc
tacaacgtgaccaagatgcccaacctggtggggcacgagctgcagacagacgccgagctg
cagctgacaactttcacgccgctcatccagtacggctgctccagccagctgcagttcttc
ctttgttcggtgtatgtgccaatgtgcacagagaagatcaacatccccatcggcccatgt
ggcggcatgtgtctttcggtcaagaggcgctgtgaacctgtcctgaaggaatttggcttt
gcctggccagagagcctgaactgcagcaaattcccaccccagaatgaccacaaccacatg
tgcatggaagggccgggtgatgaagaggtgccattacctcacaagacccccatccagcct
ggagaagagtgccactccgtaggaaccaactcggatcagtacatctgggtgaaaaggagt
ttgaactgtgttctcaagtgtggctatgatgctggcttatatagtcgctcggccaaggag
ttcacagacatctggatggccgtgtgggccagcctgtgcttcatctccactgccttcaca
gtgctgaccttcctgatcgattcttccaggttttcctaccctgagcgccccatcatattt
ctcagtatgtgctataatatttatagcattgcttatattgtcaggctgactgtaggccgg
gaaaggatatcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggactt
aagaacacaggatgtgcaatcattttcttgctgatgtactttttcggaatggctagttcc
atctggtgggttatcctgacacttacttggtttttagcggcaggactcaagtggggtcat
gaagccattgaaatgcacagctcttacttccacattgccgcctgggccatccctgcagtg
aaaaccattgtcatcttgatcatgagactggtggatgctgatgaactcactggcctgtgc
tatgtgggaaaccaaaacctcgatgccctcacaggctttgtggtggcccccctcttcact
tacttggtgataggaactttgttcatcgctgcaggtttagtggccttgttcaaaattcgg
tccaatcttcaaaaggatgggacaaagacagacaagctggaaaggctgatggtcaagatt
ggggtcttctctgtcttgtacacggttcctgccacctgtgtgatcgcctgttatttctat
gaaatctccaactgggcgctcttccggtattctgcagatgactccaatacggcagtcgaa
atgttgaaaatttttatgtctttgctggtgggcatcacttcaggcatgtggatttggtct
gccaaaactcttcacacgtggcagaagtgttctaacagattggtgaattctgggaaggtg
aagagagagaagcgaggaaacgggtgggtgaagcctgggaaaggcaatgaaactgtggta
taa

KEGG   Felis catus (domestic cat): 101095250
Entry
101095250         CDS       T02385                                 
Symbol
FZD3
Name
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101095250 (FZD3)
   04390 Hippo signaling pathway
    101095250 (FZD3)
   04150 mTOR signaling pathway
    101095250 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101095250 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101095250 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    101095250 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095250 (FZD3)
   05206 MicroRNAs in cancer
    101095250 (FZD3)
   05205 Proteoglycans in cancer
    101095250 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101095250 (FZD3)
   05226 Gastric cancer
    101095250 (FZD3)
   05217 Basal cell carcinoma
    101095250 (FZD3)
   05224 Breast cancer
    101095250 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101095250 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095250 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    101095250 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101095250 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101095250 (FZD3)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101095250 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 101095250
NCBI-ProteinID: XP_003984856
Ensembl: ENSFCAG00000024323
UniProt: M3X5H1
LinkDB
Position
B1:52018265..52119112
AA seq 666 aa
MAMSWIVFYVWPLTIFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSELMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPSQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSTSRLTDHSRHSSSHRLNEQSRHSSIRDLSSNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctacgtttggcccttgactatatttgtggggcatata
ggtgggcacagtttgttttcttgcgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcactatgaccaacagacagctgcttta
gcaatggagccattccacccaatggtgaatctggattgttctcgggattttcggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcaacgggcttacagtgagtgttcggagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggtgatcctactgaaggagctccagtggcagtgcagagggac
tatggtttttggtgtcctcgagaattgaaaattgatcctgatcttggttattctttttta
cacgtgcgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttcg
tttgctcgatacttcataggattgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagcccttcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctatttcatgccagtgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggagtttctctcctcttagctggcattatatccttaaacagagtt
cgaattgaaattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctctatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctcttatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactacaggaacctgattttgctcagtctctcctgagggatcca
aatactcctattataagaaaatcaaggggaacttccactcaaggaacatccacacatgct
tcttcaacccagcttgctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtaagcagctaccacggcagtctccacagatcccgtgatggcaggtatacgccctgc
agttacagaggaatggaagagaggctccctcatggcagcacatcacgactgaccgatcac
tccagacacagtagttctcatcggctcaatgaacagtcacggcatagcagcatcagagat
ctcagtagtaatcctatgactcacatcacacatggtaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

KEGG   Felis catus (domestic cat): 101097508
Entry
101097508         CDS       T02385                                 
Symbol
FZD5
Name
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101097508 (FZD5)
   04390 Hippo signaling pathway
    101097508 (FZD5)
   04150 mTOR signaling pathway
    101097508 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101097508 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101097508 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097508 (FZD5)
   05205 Proteoglycans in cancer
    101097508 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101097508 (FZD5)
   05226 Gastric cancer
    101097508 (FZD5)
   05217 Basal cell carcinoma
    101097508 (FZD5)
   05224 Breast cancer
    101097508 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101097508 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097508 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    101097508 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101097508 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101097508 (FZD5)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101097508 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 101097508
NCBI-ProteinID: XP_023115414
LinkDB
Position
C1:complement(194200560..194208341)
AA seq 590 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPAGAPASGG
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGATAAGDYEASASLTGRTGPPGPPAAAAAAAAYHKQVSLSHV
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcaccgccctccctgctgctgctgctcctggcgcagctg
gcgggccgggcggcagctgcctccaaggccccagtgtgccaggaaatcacagtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgcccgactaccacaag
ccgctgccgccctgccgctccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggccggagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcccttcccggccaaacccaccctcccgggccccgcgggcgcaccggcctcagggggc
gagtgcgccgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtccccatcttg
aaggagtctcacccgctctacaacaaggtgcgcacgggccaggtgcccaactgcgccgtg
ccctgctaccagccctccttcagccccgacgagcgcacgttcgccaccttctggattggg
ctgtggtctgtgctgtgcttcatctccacctccaccacggtagccaccttcctaatagac
atggaacgcttccgctaccctgagcgtcccatcatcttcctgtccgcctgctacttgtgc
gtgtcgctgggcttcctggtgcgcctggtggtgggccacgccagcgtcgcctgcagccgc
gagcacagccacattcactacgagacgacgggccctgcactgtgcactgtcgtcttcctg
ctggtctacttctttgggatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagctggcatgaagtggggcaacgaggccatcgcgggctatgcacagtacttc
cacctggccgcgtggctcatccccagcgtcaagtccatcacggcgctggcactgagctcc
gtggatggggacccggtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcaccctcttcctcctg
gcggggttcgtgtcgctcttccgcatccgaagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggtatcttcactctcctgtacacggtgccc
gccagcatcgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggcc
gcgctcacctgcgcgtgcccgggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atttggtccggcaagactgtggagtcgtggcggcgcttcaccagccgatgctgctgccgc
ccgcggcggggccacaagagcggcggcgccacggccgcgggggactatgaggcgagcgcc
tcgctcacgggcaggaccgggccgccgggcccccccgccgccgccgccgccgccgccgcc
taccacaagcaggtgtccctgtcgcacgtgtag

KEGG   Felis catus (domestic cat): 101101229
Entry
101101229         CDS       T02385                                 
Symbol
FZD8
Name
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101101229 (FZD8)
   04390 Hippo signaling pathway
    101101229 (FZD8)
   04150 mTOR signaling pathway
    101101229 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101101229 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101101229 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101229 (FZD8)
   05205 Proteoglycans in cancer
    101101229 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101101229 (FZD8)
   05226 Gastric cancer
    101101229 (FZD8)
   05217 Basal cell carcinoma
    101101229 (FZD8)
   05224 Breast cancer
    101101229 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101101229 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101229 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    101101229 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101229 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101101229 (FZD8)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101101229 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 101101229
NCBI-ProteinID: XP_023112327
LinkDB
Position
B4:complement(32611063..32615129)
AA seq 672 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPNPPRRLPPPPPGEQPPSGS
GHGRPPGARPPSRGRGGGGVDAAAPPTRGGGGGGGGKARPPGGGSAPCEPGCQCRAPMVS
VSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFL
IDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGTGGAGGAAAAA
GAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILS
LTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSL
DNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTV
LYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGI
TSGVWVWSGKTLESWRALCTRCCWASKGASGGAGAGVAGGGGVPGGGGGVGSGGGGVPGG
GRDPSTATSAPA
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctctttgctggccgccttggcgctgttgcag
cgctcgagcggtgcggcggctgcctcggctaaggagctggcttgccaagagatcaccgtg
ccgctgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggccttgaggtgcaccagttctggccgctagtagagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagcccctgcctccttgccgctcggtctgcgagcgcgccaaggccggctgcgcaccc
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgccggag
cagggcaaccccgacacgctgtgcatggactacaaccgcaccgacctcaccacagccgca
cccaatccgccgcgccgcctgccgccgccgcccccgggtgagcagccgccctccggcagt
ggccacggccgcccgcccggggccaggcccccgtcccgcggcaggggcggtggcggcgtg
gacgcagcggcgccccccacgcgcggcggcggcggcggcggcggcgggaaggcgcggccc
cctggcggcggctccgctccctgcgagccgggctgccagtgccgcgcgcccatggtgagc
gtgtccagcgagcggcatcccctctacaaccgcgtcaagaccggccagattgccaactgc
gcgctgccctgccacaaccccttcttcagccaggacgaacgcgccttcaccgtcttctgg
atcggcctgtggtctgtgctgtgcttcgtgtccaccttcgccaccgtctccaccttcctc
atcgacatggagcgcttcaagtatcctgagcggcccattatcttcctgtcggcctgctac
ctcttcgtgtctgtcggctacctggtacgcctggtggcgggccacgagaaggtggcatgc
agcggcggcgcgcccggagcgggcggtacgggaggcgcgggcggcgcggcggcggcagcg
ggcgcgggcgcggcgggcgcgggcgcgggtggccctggcgggcgcggcgagtacgaagaa
ctgggcgctgtggagcagcacgtgcgctacgagaccacgggcccagcgctgtgcaccgtg
gtcttcttgctcgtctacttcttcggcatggccagctccatctggtgggtgatcctgtcg
ctcacgtggttcctggcagcgggcatgaaatggggcaatgaggccatcgctggctactcg
cagtacttccacctggccgcgtggctcgtgcccagcgtcaagtctatcgccgtcctggcg
ctcagctccgtggacggcgacccggtggccggcatctgctacgtgggcaaccagagcctc
gacaacctgcgcggcttcgtgctagcgccgctcgtcatctacctcttcatcggcaccatg
ttcctgctggccggcttcgtgtcgctcttccgcatccgctcagtcatcaagcagcagggc
ggccccaccaagacgcacaaactggagaagctcatgatccgcctgggtctcttcaccgta
ctctacaccgtgcccgccgccgtcgtggtcgcctgcctcttctatgagcagcacaaccgc
ccgcgctgggaggccacgcacaactgcccgtgtctgcgggacctgcagccagaccaagcg
cgccggcccgactacgccgtcttcatgctcaagtacttcatgtgcctcgtggtgggcatc
acctcgggcgtgtgggtctggtccggcaagactctcgagtcgtggcgcgccctgtgcacc
cgctgctgctgggccagcaagggtgcttcggggggcgctggcgctggggtcgcagggggg
ggtggggtgccgggaggtggtgggggcgtggggtccggtgggggcggggtcccgggcggt
gggcgggatccctctacagcgacgtcagcaccggcctga

KEGG   Felis catus (domestic cat): 101101443
Entry
101101443         CDS       T02385                                 
Symbol
FZD6
Name
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04916  Melanogenesis
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101101443 (FZD6)
   04390 Hippo signaling pathway
    101101443 (FZD6)
   04150 mTOR signaling pathway
    101101443 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101101443 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101101443 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101443 (FZD6)
   05205 Proteoglycans in cancer
    101101443 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101101443 (FZD6)
   05226 Gastric cancer
    101101443 (FZD6)
   05217 Basal cell carcinoma
    101101443 (FZD6)
   05224 Breast cancer
    101101443 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101101443 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101443 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    101101443 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101101443 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101101443 (FZD6)
G protein-coupled receptors [BR:fca04030]
 Frizzled / Smoothened family
  101101443 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC
Other DBs
NCBI-GeneID: 101101443
NCBI-ProteinID: XP_023104039
Ensembl: ENSFCAG00000005027
LinkDB
Position
F2:51129765..51174330
AA seq 712 aa
MEMFPFLWTCIFLPFTRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSTAAVKMEL
FLPLANLECSPNVETFLCKAFVPTCTEQIRVVPPCRKSCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETVPVTFDPHTQFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNRTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCFCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRMTWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFRRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITDHDYLGQETLTEIQTSPETSVREV
RADGASTPRSREHDCGDPASPAASSSRLCGEQADGKGRAGNGNDKISVSESTRSEGRVTP
KSDVPETGPVQSSGLQVPGSSEPGSLKGSTSLLVHSASGGGKEQAAGGHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtttccatttttgtggacgtgtatttttctacccttcacacgaggacacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatttaatgggtcattatgaccagagtacagctgctgtgaaaatggagctt
tttcttcctcttgcaaatttggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgtacagaacaaattcgtgtggttccaccttgtcgtaaatcttgtgag
aaagtatattctgattgcaaaaagttaattgacacttttggtatccgatggcctgaagaa
cttgaatgtgacagattgcaatactgtgatgagactgttcctgtaacttttgatccacac
acacagtttcttggtcctcagaagaaaacagagcaagtccaaagagacattggattttgg
tgtcccaggcatcttaagacttctgggggacaaggctataagtttctgggaattgaccag
tgtgcacctccgtgccctaacatgtattttaaaagtgatgagctagagttcgcaaaaagt
tttatcggaatagtttcaatattttgtctttgtgcaaccctgttcacattccttactttc
ttaattgatgttaaaagattcagatacccagagagaccaattatctattactctgtctgt
tacagcattgtctctctgatgtactttataggattcttgctaggcaatcgcacagcttgc
aataaggcagatgagaagctagaactcggtgacacagtagttctaggatctcagaataag
gcttgcactgttctctttatgtttttgtattttttcacaatggctggcaccgtgtggtgg
gtgatacttaccattacttggttcttagctgcaggaagaaaatggagctgtgaagccatt
gaacaaaaagcggtgtggtttcatgctgttgcgtggggaataccaggctttctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggcgtttgctttgtcggc
ctatatgacctggatgcttctcgctactttgtgctcttgccattgtgcttttgtgtgttt
gttgggctgtctcttcttttagctggcattatttccttaaatcatgtgcgacaagttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttt
agtggcctctatcttgtaccattagtgacacttctcggatgttatgtctatgagcaagtg
aacaggatgacctgggagataacttgggtctctgaccactgtcgtcagtaccacatcccg
tgtccttatcaggccaaaacagaaactcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagagtgggcagggttttttagacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggagtcgtgtgagttcttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacg
agcacaggtgccacggccaatcacggcacttccgcagtagcgatcacggaccacgattac
ttaggacaagaaactttgacagaaatacaaacctccccagaaacatcagtgagggaggtg
agagcagatggagcgagcacccccagatcaagagaacatgactgtggggatcctgcctcc
ccagcagcatccagctccagactctgtggagaacaggctgacgggaaaggccgggcaggc
aacgggaatgataagatcagtgtatccgaaagtacgcggagtgaaggaagggtgactcca
aaaagtgatgtccccgagaccggcccggtgcagagcagcggcttgcaggtcccaggttct
tcggagccaggcagcctgaaaggctccacgtccctgctcgttcactcagcttcgggaggt
ggaaaagagcaggccgctggcggtcactccgatacttga

DBGET integrated database retrieval system