KEGG   Felis catus (domestic cat): 101081210
Entry
101081210         CDS       T02385                                 
Symbol
FLNC
Name
(RefSeq) LOW QUALITY PROTEIN: filamin-C
  KO
K04437  filamin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04510  Focal adhesion
fca05132  Salmonella infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101081210 (FLNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081210 (FLNC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101081210 (FLNC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101081210 (FLNC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101081210 (FLNC)
   04147 Exosome [BR:fca04147]
    101081210 (FLNC)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101081210 (FLNC)
  Intermediate filaments
   Intermediate filament-binding proteins
    101081210 (FLNC)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101081210 (FLNC)
SSDB
Motif
Pfam: Filamin CH Big_3_5 CFSR Invasin_D3 CH_2
Other DBs
NCBI-GeneID: 101081210
NCBI-ProteinID: XP_003983071
Ensembl: ENSFCAG00000000954
LinkDB
Position
A2:146885340..146912624
AA seq 2720 aa
MMNNSSYSEAAGLGLGDEVDDMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEEDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPHGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKNRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDSTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYHP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLKTGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAAPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDXRAAGKGDLNLYAQDADGCPVNIMVI
PNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG
RYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLNRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAETQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIHNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPTRVHVQPAVDTSGVKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRVRAFGPGLESGLVNKANHFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTAGDYDVNITFGGRPIPGSPFRVPVKD
VVDPGKVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDKGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPMP
HVEEPPDVLQPHRPGPYPTHWATEEPVVPVEPMESMLRPFNLVIPFTVQKGELTGEVRMP
SGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAY
GPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGD
YSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPS
GNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKVR
VWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEP
GTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLKIPGNWF
QMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDF
LGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKMEAAEIVEGEDSAYSVRFVPQEMGP
HTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEISFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLS
DDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKHT
IRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSE
FIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVG
SPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPGL
SQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYI
LIVKWGDESVPGSPFKVNVP
NT seq 8163 nt   +upstreamnt  +downstreamnt
atgatgaacaacagcagctactcagaggccgccggcctcggcctgggcgacgaggtggac
gacatgccgtccacggagaaggacctggcggaggacgcgccgtggaagaagatccagcag
aacacgttcacgcgctggtgcaacgagcacctgaagtgtgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtatcgcaagttccacccgcgccccaacttccgccagatgaagctggagaac
gtgtccgtggccctcgagttcctggagcgcgagcacatcaagctcgtgtccatcgacagc
aaggccattgtggatgggaacctgaagctgatcctgggtctgatctggacgctgatccta
cactactccatctccatgcccatgtgggaggatgaggaggacgaggacgcccgcaagcag
acgcccaagcagcgtctgctcggctggatccagaacaaggtgccccagctgcccatcact
aacttcaaccgtgactggcaggatggcaaagctctgggcgccctggtggacaactgtgcc
cctggcctgtgccctgactgggaagcctgggaccccaaccagcctgtggagaacgcccgg
gaggccatgcagcaggcggacgactggctcggggtgccccaggtgattgcccccgaggag
attgtggaccccaacgtggatgagcattctgtcatgacctacctgtcccagttccccaag
gccaaactcaaacctggtgcccctgttcgctctaaacagctgaaccctaagaaggccatc
gcctacgggcctggcatcgagccccacggcaacactgtgctacagcctgcccacttcacc
gtgcagacggtggatgccggcgtgggcgaggtgctggtctacattgaggaccctgagggc
cacaccgaggaggccaaagtggttcccaacaatgacaagaaccgcacctatgctgtctcc
tatgtgcccaaggttgcggggttgcacaaggtgactgtgctctttgctggccagaatatc
gaacgcagtccctttgaggtgaacgtgggcatggctctgggagatgccaacaaggtgtca
gcccgtggccctggcctggagcctgtgggcaatgtggccaacaaacccacgtactttgac
atctatactgcgggggccggcactggtgatgttgccgtggtgatcgtggacccgcagggc
cggcgggacacagtggaggtggccctggaggacaagggcgacagcacgttccgatgcacg
tacaggcctgtgatggaggggccccacacggtgcatgtggccttcgctggtgcccccatc
acccgcagtcctttccccgtccatgtagctgaagcctgtaaccctaacgcctgccgtgcc
tctgggcggggcctgcagcccaagggtgtgcgtgtgaaagaggtggctgatttcaaggtg
ttcactaagggtgccggcagcggggagctcaaggtcacagtcaaagggccaaagggcaca
gaagagccagtgaaagtgcgagaggctggagatggcgtgttcgagtgtgagtaccaccct
gtggtgcctgggaagtatgtggtgaccatcacgtggggcggctacgccatcccccgcagt
ccttttgaggtacaggtgagcccagaggcaggagcgcagaaggtacgggcctggggtccc
ggcctgaaaactggccaggtggggaagtcggccgactttgtggtggaggccattggcacg
gaggtggggacactgggattctccattgaggggccctcacaggccaagatcgagtgtgat
gacaagggggatggctcctgcgatgtgcggtactggcccacggagcctggggagtacgcc
gtgcacgtcatctgcgatgatgaggacatccgagactcacccttcattgcccacatccag
ccagccgcacctgactgcttcccggataaggtgaaggcctttgggcctggcctggagccc
actggctgcatcgtggacaagcctgcagagttcaccatcgatngccgtgctgctggcaag
ggagacctgaacctgtatgcccaggatgctgatggctgccctgtcaacatcatggtcatc
cccaatggcgacggcaccttccgctgctcctacgtgcccaccaagcccattaaacacacc
atcatcatctcctggggaggcgtcaatgtgcccaagagccccttccgggtgaacgtggga
gaaggcagtcaccccgagcgggtgaaggtatatggcccaggcgtggagaagacgggcctc
aaggccaacgagcctacctatttcaccgtggactgcagcgaggctgggcaaggtgacgtg
agtatcggcatcaagtgtgctcccggagtggtgggccctgcagaagctgacatcgacttt
gacatcatcaagaacgacaatgacaccttcacagtcaagtacacccccccaggggccggc
cgctacaccattatggtgctgtttgccaaccaggagatccctgccagccccttccacatt
aaggtggacccatcccacgatgccagcaaagtcaaggctgagggccctgggctgaaccgc
acgggtgtggaagtcgggaagcccactcacttcacggtgctgaccaagggagccggcaag
gccaagctggacgtgcactttgccggggctgccaagggtgaggccgtgcgggactttgaa
atcatcgacaaccatgactactcctacactgtcaagtacacagccgtccagcagggcaac
atggcagtgacggtgacctacggtggggaccctgtccccaagagcccctttgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagttcaaggcctgaacagcaaggtggct
gtggggcaagaacaggccttctctgtgaacacacgtggggctggcggtcaagggcagctg
gatgtgcggatgacttcaccctcccgtcgccccatcccttgcaagctggagcctgggggc
ggagctgaaacccaggccgtgcgctacatgccccctgaggagggaccctacaaggtggac
atcacctacgacggtcacccagtgcccggtagcccctttgctgtggagggtgtcctgccc
cctgatccctccaaggtttgtgcgtatgggcccggtctcaagggcggcctggtaggcacc
ccggcaccgttctccattgacaccaagggggctggcacgggcggcctggggctgactgtg
gagggcccctgtgaggccaagattgagtgccaggacaacggtgatggctcatgtgctgtc
agctacctgcccacggagcccggcgagtacaccatcaacatcctgtttgccgaagcccac
atccctggctcacccttcaaggccaccatccggcccgtgttcgacccgagcaaggtgcgg
gccagtgggccgggcctggagcgtggcaaggctggcgaggcggccaccttcacggtggac
tgctcggaggctggcgaggctgagctgaccatcgagatcctgtcggacgccggtgtcaag
gccgaggtgctgatccacaacaatgccgacggcacctaccacatcacctacagccccgcc
tttcctggcacctacacaattaccatcaagtatggcgggcaccctgtccccaaattccct
acccgcgtccacgtgcagcctgctgtcgacaccagtggagtcaaggtctcagggcccggg
gtggagcctcacggtgtcctgcgtgaggtgaccactgagttcactgtggacgcaagatcc
ctaacagccacaggtgggaaccacgtgacagctcgtgtgctcaacccctcgggtgctaag
acggacacctatgtgacagacaacggggacggcacctaccgagtgcagtacacagcctat
gaagagggcgtgcatctggtggaggtcctgtatgatgacgtagctgtgcccaagagcccc
ttccgagtgggcgtgaccgagggctgtgaccccacccgcgtgagggcctttgggcctggc
ctggagagcggcttggtcaacaaggccaaccacttcactgtggagaccaggggagctggc
accggaggcctcggcctagccatcgagggcccctcagaagccaagatgtcctgcaaggac
aacaaagatggtagctgtaccgtggagtacatccctttcaccgctggagactacgacgtc
aacatcacctttggggggcggcccatcccagggagcccgttccgggtgccggtgaaggat
gtggtggaccctgggaaggtgaagtgctcagggccggggctgggggccggtgtcagggcc
cgggtaccccagaccttcacggtggactgcagccaagccggccgggccccactgcaagtg
gccgtgctgggccccacaggtgtagccgagcctgtagaggtgcgtgacaagggagatggc
acccacaccgtccactacaccccagccaccgatgggccctacacggtagccgtcaagtat
gccgaccaggaggtaccacgcagccctttcaagatcaaggtgcttcctgcccatgatgcc
agcaaggtgcgggccagcggccccggcctcaacgcctctggcatccctgccagcctgccc
gtggagttcaccatcgatgcccgggatgccggtgagggtttgctcaccgtccagatcctg
gacccggagggaaagcccaagaaagccaacatccgagacaacggggatggcacgtacact
gtgtcctacctgccagacatgagtggccggtacaccatcaccatcaagtatggcggcgac
gagatcccctactcgcccttccgcatccacgccctgcccactggggatgccagcaagtgt
cttgtcacagtgtccattggaggccatggcctgggtgcctgcttgggaccccgcatccag
atcggggaggagacagtgatcacggtggacgccaaggcggcaggcaaggggaaggtgacg
tgcacggtgtccactccggatggggcggagctcgacgtggatgtggttgagaaccacgac
ggtacctttgacatctactatacagcgcccgagccgggcaagtacgtcatcaccatccgc
tttggaggcgagcacatccccaacagccccttccacgtgctggcgtgtgaccccatgccc
cacgtggaggagcctcccgatgtgctgcagccgcaccggcccggcccctaccccacacac
tgggccacagaggagccagtggtgcctgtagagccaatggagtccatgcttaggcccttc
aacctggtcatccccttcaccgtgcagaaaggggagctcacaggggaggtacggatgccc
tctgggaaaacagcccggcccaacatcaccgacaataaggatggaaccatcacggtgagg
tatgcacccaccgagaaaggcctgcaccagatggggatcaagtatgacggcaaccacatc
cctggaagccccctgcagttttatgtggatgccatcaatagccgccatgtgagtgcttat
gggccaggcctgagccatggcatggttaacaagccggccaccttcaccattgtcaccaag
gatgctggggaagggggcctgtccctggctgtggagggcccatccaaggcagagatcacc
tgcaaggacaacaaggacggcacctgcaccgtatcctacttacccacagcgcctggagac
tacagcatcatcgtgcgctttgatgacaagcacatcccaggaagccccttcacggccaag
atcacaggcgatgactccatgaggacatcacagctcaatgtgggcacctccacggatgtg
tcactgaagatcacggagagtgacctgagcctgctgactgccagcatccgcgccccctca
ggcaacgaggagccctgcctattgaagcgcctgcccaacaggcacatcggcatctccttc
accccgaaggaggttggggagcacgtggtaagcgtgcgcaaaagtggcaagcatgtcacc
aacagccccttcaagatcctggtggggccatctgagatcggagatgccagcaaggtgcgg
gtctggggcaagggcctgtccgagggacacaccttccaggtggcggagttcatcgtggac
actcgcaacgcaggttacgggggcctggggttgagtattgaaggccctagcaaggtggac
atcaactgtgaggacatggaagatggcacatgcaaagtcacctactgccccaccgagcct
ggcacctacatcatcaacatcaaatttgctgacaagcacgtgcctggaagcccgttcact
gtgaaggttaccggtgagggtcgcatgaaggaaagcatcacgcggcggagacaggcacct
tccattgccaccattggcagcacctgtgacctcaatctcaagatcccagggaactggttc
cagatggtgtctgcccaggagcgcctgacgcgcaccttcacacgcagcagccacacatac
acccgcacagaacgcacggagatcagcaagacgcgcggcggagagaccaagcgtgaggtg
cgggtagaggagtccacccaggttggtggagaccccttccccgcggtcttcggggacttc
ttgggccgggagcgcctgggctcctttggcagcatcacccggcagcaggagggggaggcc
agttcccaggacatgactgcacaggtgaccagcccatcgggcaagatggaagccgcagag
attgtcgagggagaagacagcgcgtacagtgtgcgttttgtgccccaggaaatggggccc
cacacagtcaccgtcaagtaccgcggccagcacgtacctggcagtccctttcagttcact
gtggggccgctgggtgaaggtggtgcccacaaagtgcgggctggaggcacaggactggag
cgaggtgtggccggtgtgccagctgaattcagcatttggacccgagaagctggtgctgga
ggcctgtctattgccgtggagggtcccagcaaggcggagatttcatttgaggaccgaaaa
gatggctcctgtggggtctcctatgttgtccaggaaccaggtgactatgaggtctccatc
aagttcaatgatgaacacataccagatagtccttttgtggtacctgtggcctccctctca
gatgatgctcgccgcctcactgtcaccagcctccaggaaacagggctcaaggtgaaccag
ccggcgtcctttgcggtgcagctgaatggtgctcggggtgtgattgatgcaagggtgcac
acgccctcgggtgcggtggaggaatgctacgtctctgagctggacagcgacaagcacacc
atccgcttcatcccccacgagaacggcgtccactctattgatgtcaagttcaacggtgcc
cacatccctggcagtcccttcaagatccgcgttggggaacagagccaggctggggaccca
ggcttggtgtcagcttatggtcctggacttgagggaggcactactggcgtgtcatcagag
ttcattgtcaacaccctgaatgcgggctcaggggccttgtctgtcaccatcgatggcccc
tccaaggtgcagctggactgtcgggagtgtcctgagggccatgttgtcacttacactccc
atggcgcctggcaactacctcattgccatcaagtacggtggcccccagcacatcgtgggc
agccccttcaaggccaaagtcacaggtccccggctgtctggaggccacagccttcatgaa
acatccacagttctggtggagaccgtgaccaaatcctcctcaagccgtggctccagctac
agctccatccccaagttctcctcggatgccagcaaggtggtgacacggggccctgggctg
tcccaggcctttgtgggccagaagaactccttcaccgtggactgcagcaaagcaggcacc
aacatgatgatggtgggcgtgcatgggcccaagaccccctgtgaagaggtgtacgtgaag
cacatggggaaccgggtctacaatgtcacctacaccgtcaaggagaaaggggactacatc
ctcattgtcaagtggggcgacgaaagtgttcccggaagccccttcaaagtcaacgtgccc
tga

KEGG   Felis catus (domestic cat): 101082637
Entry
101082637         CDS       T02385                                 
Symbol
FLNA
Name
(RefSeq) filamin-A isoform X1
  KO
K04437  filamin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04510  Focal adhesion
fca05132  Salmonella infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082637 (FLNA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101082637 (FLNA)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101082637 (FLNA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101082637 (FLNA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101082637 (FLNA)
   04147 Exosome [BR:fca04147]
    101082637 (FLNA)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101082637 (FLNA)
  Intermediate filaments
   Intermediate filament-binding proteins
    101082637 (FLNA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101082637 (FLNA)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 CFSR
Other DBs
NCBI-GeneID: 101082637
NCBI-ProteinID: XP_023105179
Ensembl: ENSFCAG00000011393
LinkDB
Position
X:complement(129188026..129214016)
AA seq 2647 aa
MSSSHSRAGQSAAGAAPGGGTDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVDVVI
QDPTGQKGAVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRIQVQDNEGCPVE
ASVKDNGNGTYSCSYVPRKPVKHTAVVSWGGVNVPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGIELGKPTHFTVNAK
AAGKGKLDVQFTGLAKGDVARDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDPIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKITGPSGTVVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEALPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGMGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVMYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNQDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPTAQPPLRPQQLAPPYTYPQGGQQTWAPERPLMGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLSHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKTASAPQHGAPGAGSTDASKVLAKGLGLSKAYAGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVLVP
NT seq 7944 nt   +upstreamnt  +downstreamnt
atgagtagctcccactcccgggcgggccagagcgcggcaggcgcggctccgggcggcggt
accgacacgcgggacgccgagatgccagccaccgagaaggacctggcggaggacgcgccg
tggaagaagatccagcagaacacgttcacgcgctggtgcaacgagcacctcaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgatgggctgcggctcatcgcactg
ctggaggtgctcagccagaagaagatgcaccgcaagcacaaccagaggcccaccttccgc
cagatgcagctggagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaag
ctcgtgtccatcgacagcaaggccatcgtggatgggaacctgaagctgatcttaggcctc
atctggaccctgatcctgcactactccatctctatgcccatgtgggatgaggaggaggac
gaggaagccaagaagcagacccccaagcagcggctcctgggctggattcagaacaagctg
ccacagctgcccatcaccaactttagccgggactggcagagcggcagggccctgggcgcc
ctcgtcgacagctgtgccccaggcctgtgtcctgactgggactcctgggacgccagcaag
cccgtgaacaacgcgagggaggccatgcagcaggccgatgactggctgggcattcctcag
gtgatcacgcccgaggagatcgtggatcccaacgtagacgagcactccgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctccgctgcggcccaaactaaac
ccaaagaaagcccgcgcctacgggccaggcatcgagcccacgggcaacatggtgaagaag
cgggcagaattcacggtggagaccagaagcgccggccagggagaggtgctggtgtatgtg
gaggacccggccggccaccaggaggaggcaaaggtgacagccaataatgacaagaaccgt
accttctctgtctggtacgtccccgaggtgaccgggactcacaaggtcaccgtgctcttt
gccggccagcatatcgccaagagtcccttcgaggtgtatgtggacaagtcccagggtgat
gccagcaaagtgactgcccagggccccggcctggagcccagtggcaacattgccaacaag
accacctactttgagatcttcacggcaggagctggcacgggtgaggtggacgttgtgatc
caggaccccacgggacagaagggcgccgtggagccccagctggaggcccggggcgacagc
acataccgctgcagctaccagcccaccatggagggcgtccacacggtgcacgtcactttt
gccggcgtgccgatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
ggtgcctgccgcgccgtcggccggggcctgcagcccaagggtgtgcgggtgaaagagact
gcggacttcaaggtgtacacgaagggcgcgggcagcggggagctgaaggtcaccgtgaag
ggtcccaagggtgaggagcgtgtgaagcagaaggacctgggggacggcgtttatggcttc
gagtattaccccatggtccccggcacctacactgtcaccatcacgtggggcggccagaac
attgggcgcagtcccttcgaggtgaaggtgggcacggagtgtggcaatcagaaggtgcgg
gcctggggccctgggctggaagggggtgtcgtcggcaagtcagcagactttgtggtggag
gccatcggggacgatgtcggcaccttgggcttctcggtggagggcccatcgcaggccaag
attgaatgcgacgacaagggcgacggctcctgtgatgtgcgctactggccccaggaggct
ggcgagtatgcagtgcatgtgctgtgcaacagtgaggacatccgcctcagccccttcatg
gccgacatccgtgaggcgccccaggacttccacccagatagggtgaaggcgcgcgggcct
gggttggagaagacgggtgtggccgtcaataagccagccgagttcacggtggatgccaag
catggcgggaaggcccctctccggatccaagtccaggacaacgagggatgccccgtggag
gcgtcggtcaaggacaacggcaacggcacttacagctgctcctacgtgcccaggaagcct
gtgaagcacacggccgtggtgtcctggggaggcgtgaacgtccccaacagccccttccgg
gtgaacgtgggagccggtagccacccaaacaaggtcaaggtgtatggccccggagtagcc
aagaccgggctcaaggctcatgaaccaacgtacttcactgtggattgcacagaggccggc
cagggtgatgtcagcatcggcatcaagtgtgctcctggcgtggtgggccccactgaggcc
gacattgacttcgacatcatccgtaatgacaatgacaccttcacggtgaagtatacaccc
cgcggggccggtagctataccatcatggtcctctttgccgaccaggccacacccaccagc
cccatccgggtcaaggtggagccctcccacgatgccagcaaggtgaaggctgagggccct
ggcctcagtcgcactggtattgagcttggcaaacccacccacttcacggtcaatgccaaa
gctgctggcaaaggcaagctggacgtccagttcacaggactggccaagggggatgtggcg
cgtgatgtggacatcatcgaccaccatgacaacacctacacggtcaagtacactcccgtg
cagcagggtccagtcggcatcaatgtcacttacggaggggatcccatccccaagagcccc
ttctcggtgggagtgtctccaagcctagacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagatcaggaattcacagtcaaatcgaagggcgctggtggc
caaggcaaagtggcatccaagatcacaggcccctcgggcactgtagtgccctgcaaggtg
gagccaggcctaggggctgacaacagtgtggtgcgctttgtgccccgagaggaggggccc
tatgaggtcgaggtgacttatgatggtgtgcctgtgcccggcagcccctttcctctggaa
gccctgccccccaccaagcctagcaaggtgaaggcgtttgggccgggcctgcaggggggc
agcgcaggctcccccgcccgcttcactatcgacaccaagggtgctggcatgggtggcctg
ggcctgacggtggaaggcccctgcgaggcccagctcgagtgcctggacaacggagacggc
acgtgctccgtgtcctatgtgcccaccgaacccggggactacaacatcaacatccttttt
gccgacacccacatccctggctcccccttcaaggctcacgtggtcccctgcttcgacgcg
tccaaagtcaaatgctcaggccccgggttggagcgggccactgctggtgaggcgggccag
ttccacgtggactgctcgagtgcgggcagcgcagagctgaccatcgaaatccgctctgag
gcagggctgcccgctgaggtgcacatccaggaccacggcgacggtacccacaccatcacc
tacatcccgctttgccccggggcctacaccgtcactatcaagtatggtggccagcccgtg
cccaacttccccagcaagctacaggtagagcccgcggtggacacttcaggcgtccagtgc
tatgggcctgggatcgagggccaaggtgtcttccgagaggctaccaccgagttcagcgtg
gatgcccgcgctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgaccgagacgtacgtgcaggactgtggtgacggcacgtacaaagtggag
tacacaccttacgaggagggactccattctgtggacgtgacctatgacggcagccccgtg
ccaagcagccccttccaggtgcctgtgaccgagggctgtgacccttcccgggtgcgtgtc
catgggccaggtatccaaagcggcacaaccaacaaacccaacaagttcaccgtggagact
aggggagccggcactggtggcctgggcctggccgtagagggcccctccgaggccaagatg
tcctgcatggacaacaaggatggcagctgttcagtcgaatacatcccctatgaggctggc
acctacagccttaacgtcacctatggtggccaccaagtaccaggcagtcccttcaaggtc
cctgtgcatgacgtgacggacgcatccaaggtcaagtgctccgggcctggcctgagccct
ggcatggtccgcgccaacctccctcagtccttccaggtagacacgagcaaggccggcgtg
gccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagcctgtggacgtcgtg
gacaatgcggatggcacccagactgtaaactacgtgcccagccgggaggggccctacagc
atctccgtgatgtacggggaggaggaggtaccccgcagccccttcaaggtcaaggtgctg
cctacacacgatgccagcaaggtgaaggccagcggccccgggctcaatacgactggcgtg
cccgccagcctccctgtggagttcaccatcgatgcaaaggatgcaggagagggcctgctg
gctgtccagatcacggaccccgagggcaagcccaagaagacgcacatccaagacaaccag
gacggcacgtacaccgtggcctatgtgccggatgtgaccggccgctacaccatcctcatc
aagtacggtggtgacgagatccccttctccccgtatcgcgtccgggccgtgcccaccgga
gatgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggcatt
ggccccaccatccagattggggaggagacggtgatcaccgtcgacaccaaggcagcaggc
aaaggcaaggtgacctgtactgtgtgcacacccgacggctcggaggtagatgtggacgtg
gtagagaacgaggacggcacctttgacatcttctacacggccccccagccgggcaaatat
gtcatctgcgtgcgctttggtggcgagcacgtgcccaacagccctttccaagtgacggct
ctagctggggaccagcccacagcacagcccccacttcggcctcagcagctggccccaccg
tacacctatccccagggtggccagcagacctgggccccagagagacccttaatgggtgtc
aatgggctggatgtgaccagcctgaggcccttcgacctcgtcatccccttcaccatcaag
aaaggcgagatcactggggaggtgcggatgccttcgggcaaggtggcgcagccagccatc
actgacaacaaggacggcactgtgaccgtgcgctatgcacccagcgaagcaggcctgcac
gagatggacatccgctacgataacatgcacatcccaggaagccccctgcagttctacgtg
gactatgtcaactgcggccacgtcaccgcctatgggcctggcctcagccacggagtggtg
aacaagcccgcggtcttcaccgttaacaccaaggatgcgggagaggggggcctgtccctg
gccattgagggcccatccaaagcagagatcagctgcaccgacaaccaggatggcacgtgc
agcgtctcctaccttcccgtgctgcccggggactatagcatcctggtcaagtacaacgag
cagcacatcccgggcagccccttcaccgccagggtcacgggcgacgactcgatgcgcatg
tcccacctgaaggtgggctccgccgccgacatccccatcaatatctccgagacggacctc
agcctgctgacagccacggtagtgccaccctcgggccgggaggagccctgtctcctgaag
cgactgcgcaatggccacgtggggatctcattcgtgcccaaggagacgggggagcacctg
gtgcacgtgaagaagaatggccagcacgtggcaagcagccccatcccagtggtgatcagc
cagtcggagatcggggatgccagccgtgtgcgggtctcaggccagggcctccacgagggc
cacacctttgagcctgcagagtttatcatcgacacccgtgatgcaggctacggcggactt
agcctgtccatcgagggccccagcaaggtggacatcaacacagaggacctggaggatggc
acgtgcagggtcacctactgccccacagagcccggaaactacatcatcaacatcaagttc
gctgaccagcacgtgcctggcagccccttctctgtgaaggtaacaggagagggccgggtg
aaagagagcatcacacgccggcgacgggccccctcagtggccaatgtcggcagtcactgc
gacctcagcctgaagatccctgaaattagcatccaggacatgacagcccaggtgaccagc
ccatcaggcaagagccatgaggccgagatcgtggaaggggagaaccacacctattgcatc
cgctttgtgcctgccgagatgggcatgcacacagttagcgtcaagtacaagggccagcac
gtgcccgggagccccttccagttcaccgtggggcccctgggggaagggggagcacacaag
gtccgcgctggaggccctggcctggagagggctgaagccggagtgccagccgaatttagc
atctggaccagggaagctggcgccgggggcctggccattgctgtcgagggccccagcaag
gccgagatctccttcgaggaccgcaaggacggctcctgtggcgtggcctacgtggtccag
gagccaggtgactacgaggtctcagtcaagttcaacgaggagcacatccctgacagcccc
ttcgtagtacctgtggcttctccgtctggcgatgcccgccgccttactgtttctagtctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgctaaggtgcacagcccctcgggagccctggaggagtgctatgtc
acagagatcgaccaagataagtatgccgtgcgctttatcccacgggagaacggtgtctac
ctgattgacgtcaagttcaacggcacccacattcctggaagccccttcaagatccgagtt
ggggagcctgggcacggaggggacccgggcctggtgtccgcctacggagccggcctggaa
ggtggtgtcacagggagcccagcagagttcatcgtgaacacgagcaacgcgggagccggc
gccctgtccgtaaccatcgatgggccctccaaggtgaagatggactgccaagagtgccct
gagggctaccgggtcacctacacccccatggcacctggcagctacctcatctccatcaag
tacggtggcccctaccacatcgggggcagccccttcaaggccaaagtcacaggtccccgt
cttgtcagcaaccacagcctccatgagacatcgtcagtgttcgtggactccctgacgaag
actgccagtgccccccagcacggggccccaggcgcaggttccactgacgccagcaaggtg
ctggccaagggcctggggctgagcaaggcgtacgccggccaaaagagcagcttcacggtg
gactgtagcaaagcaggcaacaacatgctgctggtaggggtgcatggcccccggacaccg
tgcgaggaaatcctggtgaagcatgtgggcagccggctctacagcgtctcttacctgctc
aaggacaagggagagtacacgctggtggtcaagtggggtgacgagcacatcccaggcagc
ccctaccgtgtcctggtaccctga

KEGG   Felis catus (domestic cat): 101098612
Entry
101098612         CDS       T02385                                 
Symbol
FLNB
Name
(RefSeq) filamin-B isoform X4
  KO
K04437  filamin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04510  Focal adhesion
fca05132  Salmonella infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101098612 (FLNB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098612 (FLNB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101098612 (FLNB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101098612 (FLNB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101098612 (FLNB)
   04147 Exosome [BR:fca04147]
    101098612 (FLNB)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     101098612 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    101098612 (FLNB)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098612 (FLNB)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y CFSR Big_3_5 Invasin_D3
Other DBs
NCBI-GeneID: 101098612
NCBI-ProteinID: XP_003982416
Ensembl: ENSFCAG00000006518
UniProt: M3W620
LinkDB
Position
A2:25995947..26140339
AA seq 2602 aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
VQPGPHVVKVSFAGDTIPKSPFVVQVGEACSPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESVGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPAAGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFAVGVAAPLDLSKIKINGLENRVEVGK
GQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVVGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLQHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHVANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPVPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNIVDNGDGTHTVTYTPSQEGPYMISVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPKRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVEAVEEAPVNACSPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGSHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSEFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEIDSSDMSAHVTSPSGRVTEAEIVSMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGDPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKEKGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt   +upstreamnt  +downstreamnt
atgccggtaactgagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
accttcacgcgttggtgcaacgagcacctcaagtgtgtgaacaaacgcatcgggaacctg
cagaccgacctgagcgatgggctgcggctcatcgcgctgctcgaggtgctcagccagaaa
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtg
tccgtggccctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcctgggcctggtgtggacactgatcctccac
tactccatctccatgcccgtgtgggaggacgaaggggatgacgatgccaagaagcagacg
ccgaagcagaggctgctgggatggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagatggcaaggctctgggagccttggtagacagctgtgcccca
ggtctgtgtccagactgggaatcctgggatccacgcaagcctgtggacaatgcacgggaa
gctatgcagcaagcagacgactggctgggtgtcccacaggtcatcactcctgaagaaatt
attcaccccgatgtggatgagcactcggtgatgacttacctgtcccagttccccaaagcc
aagctcaagccgggagctcctctgaagcccaaactcaacccgaagaaagccagggcctat
ggccgaggaatcgagcctactggaaacatggtaaagcagccagccaagttcactgtagac
accatcagtgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgactccagacagtgacaagaacaagacatactctgtggagtatttg
cccaaggtcaccgggctgcacaaagttacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcgcagggagatgccagtaaagtcactgccaaa
ggcccaggcttggaaactgctggaaacatcgccaataagcccacctactttgacatctac
acagcaggtgccggtgtgggtgacattggtgttgaagtggaggatccccaggggaagaac
actgtggaattactggtggaagacaaaggaaaccaggtgtatagatgtgtgtacaaacca
gtacagcctggcccccatgtggtcaaggtctcctttgctggggacaccattcccaagagt
cccttcgttgtacaggttggggaagcctgtagtccaaacgcctgccgggccagtggccga
ggcctgcagcccaaaggcatccgcatccgggagactgcagacttcaaggttgataccaaa
gctgctggaagcggagaactcggtgtgactgtgaagggtcctaagggtctggaggagctg
gtgaaacagaaaggctttctggatggagtctatgcatttgagtattaccccagcaccccg
gggaaatacagcattgccatcacgtgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagttcgtgcatggggccctggcctccac
ggtgggattgtcgggcggtcggcagacttcgtggtagagtccgttggctctgaagtgggg
tctttggggtttgccatcgaaggcccctcccaggcaaagattgagtatgatgaccagaat
gatggctcatgtgacgtcaagtactggcccaaggagccgggcgaatatgccgttcacatc
atgtgtgatgatgaggacatcaaggacagcccgtacatggccttcatccatccagctgca
ggagactacaacccagatctggtccaagcttacggaccaggtttggagaaatctggctgc
attgtcaacaacctggctgagttcactgtggatcctaaggatgccggaaaagctccctta
aagatatttgctcaggatggggaaggccagcccattgacatccagatgaagagccgaatg
gacggcacgtatgcctgctcgtacaccccagttaaggccatcaagcacaccattgccgtg
gtctggggaggtgtgaacatccctcacagcccctacagggtcaatatcgggcagggtagt
catccccagaaggtcaaggtgtttgggccaggcgtggagcgaagtggactgaaggcaaat
gagcctactcatttcacagtggactgtaccgaggctggggaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgaggatgaggaagacgtggactttgacattatt
cacaacgccaacgacacgtttacggtcaaatatgtgcctcctgctgccgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtgaaagttgac
ccttcccatgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccaacccacttcactgtctataccaaaggggctggaaaggccccactg
aatgtgcagttcagcagcccccttcctggagacgccgtgaaggatttggacatcatcgac
aattacgactactctcacaccgttaaatacacacccacccagcagggcaatatgcaggtt
ctggttacctatggtggcgaccccatccctaaaagccctttcgccgtgggcgtggctgct
ccactggatctgagcaagataaaaattaatgggctggaaaacagagtcgaagtcgggaag
ggccaggagttcgccattgacacaaacggggcaggaggccaggggaagctggatgtgacg
atcctaagcccctcgaggaaggtcgtgccgtgtctggtggcgcccgtggtgggccgggag
agcagcacagccaagttcatccctcgcgaggaggggctctacgctgtagacgtcacctac
gatggacaccccgtgcctgggagcccctacacggtggaggcctcactgccaccagatccc
accaaggtgaaggcccatggtcctggccttgaaggtggtctcgtgggcaagcccgcggag
ttcaccatcgacaccaaaggagcgggcaccggaggcttgggcctcaccgtggaaggccca
tgtgaggccaaaattgaatgctctgacaatggcgatggcacgtgctctgtctcctacctg
cccacaaagcccggggagtactttgtcaacattctctttgaagaagtccatatacctggt
tctcccttcaaagccgacattgaaatgcctttcgacccctctaaagtcgtggcttcgggg
ccaggtctccagcatgggaaagtgggcgaagctgggctgctgagtgttgactgttcggaa
gcagggcccggggccctgggcctggaagccgtgtcagactcgggagcgaaagccgaagtc
tgtattgaaaacaacaaagacggcacctatgcagtgacctatgtgcccctgaccgccggc
atgtacacactgacgatgaagtatggcggcgagctcgtgccccacttccccgccagggtc
aaggtggagcccgctgtggacaccagcagggtcaaagtctttgggccaggaatagaagga
aaagatgtgtttcgtgaggccaccactgacttcacggtcgactcacggcccctgacacag
gttgggggtgaccacatcaaagcccatgttgccaacccctcaggggcctctaccgagtgc
ttcgtcacagacaatgccgatgggacctaccaggtggagtacacgccctttgagaaaggt
ctccatgtagtggaggtgacctacgatgatgtacctgtcccaaatagtcccttcaaagtg
gctgtaaccgaaggctgccagccatctcgggttcaagcccaaggacctgggttgaaagag
gcctttaccaacaaacccaatgtcttcaccgtggttactagaggggcaggaattggtggg
cttggcataactgtcgaaggcccatcagagtcgaagatcaactgcagagacaacaaagat
ggtagctgcagcgctgagtacgtcccctttgctccaggcgactatgacgttaacatcaca
tatggaggagcccacatccctggcagtcccttcagagttccagtgaaagatgtcgtggat
cctagcaaggtcaagattgctggccccggactgggctccggtgtccgagctcgcatcttg
cagtctttcacagtggacagcagcaaagccggcctggccccactggaagtgagggtcctg
ggcccacgaggcctggtggagccggtgaacatagtggacaatggggatggcacacacaca
gtgacctacaccccatcccaggaggggccttacatgatctcggttaaatacgctgatgaa
gagatccctcgtagtccctttaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccctggcctcagttcctatggtgtgcctgccagtctgcctgtggagttt
gcaatcgatgccagagatgccggggaaggcctgcttgctgttcagataacggaccaagag
ggaaagcccaaaagagccactgtccacgacaataaagatggcacgtatgccgtcacctac
atccctgacaagaccggacgctatatgattggggtcacctatgggggggatgacatccca
ttgtctccctaccgcatccgggccacacagacaggagatgccagcaagtgtctggccaca
ggtcctggaatcgcctccactgtgaaaaccggcgaggaagtgggctttgtggttgatgcc
aagaccgctgggaaggggaaagtgacctgcacggttctgaccccagacggcaccgaggct
gaggccgatgtcattgagaatgaggatggcacctacgacatcttctacacggccgccaag
ccaggcacctatgtgatctatgtgcgctttggcggcgttgatattcccaacagcccattc
actgtcatggccacagatggggaagtcgaggccgtggaggaggcaccggtaaatgcatgt
tcccccggattcaggccctgggtaaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctgggctttaagcctttcgacttggtcattccatttgcagtcagaaaaggagaaatc
accggagaggtccacatgccttctgggaagacggccacgcctgagattgtggacaacaag
gacggcacagtcaccgtcagatacgcccccactgaagtcgggctgcatgagatgcacatc
aaatacatgggcagccacatccctgagagcccgctccagttctacgtgaactacccgaac
agtgggagtgtttctgcatacggtccaggcctggtgtatggagtggccaacaaaactgcc
accttcaccatcgtcaccgaggatgcaggagaagggggcctagacttggctatcgaggga
ccttcaaaggccgaaatcagctgcattgacaacaaagatgggacatgcacagtgacctac
ctgcccaccctgccaggtgactatagcatcctggtcaagtacaatgacaagcacatccct
ggcagccccttcacggccaagatcacagatgacagcagacggtgctctcaggtaaagctg
ggctctgccgccgacttcctgcttgacatcagcgagaccgacctcagcaccctgacggcc
agcattaaggccccatctggccgtgacgagccctgtctcctgaagaggctgcccaacaac
cacatcggcatctccttcatcccccgggaggtgggtgaacacctggtcagcatcaagaag
aacggcagccacgttgccaacagccccgtgtccatcatggtggtccagtctgagatcggt
gatgcacgcagagccaaagtctatggccgtggcctgtcagagggccggactttcgaaatg
tctgaattcatcgtggacacaagggatgcgggttatggtggcatatccttggctgtggaa
ggccccagcaaagtggacatccagacagaggacctggaagatggcacctgcaaggtctcc
tacttccccactgtgcctggggtttacatcgtctccaccaagtttgctgatgagcacgtg
cctgggagcccgtttaccgtgaagatcagcggagagggaagagtcaaggagagcatcacc
cgtaccagtcgggccccgtctgtcgccactgtcggaagcatctgtgacctgaacctgaaa
atcccagaaattgacagcagtgacatgtcggcccatgtcaccagcccctctggccgcgtg
accgaggcagagattgtgtccatggggaagaactcgcactgcgtccggtttgtgccccag
gagatgggtgttcacacagtcagcgtcaagtaccgcggccagcatgtgaccggcagccct
ttccagttcacggtggggccactcggcgaggggggcgcccacaaggtccgtgcgggaggc
cccggcctggagagaggagaagcaggtgtcccagctgagttcagcatctggacccgggaa
gcaggcgctgggggcttgtccattgctgttgagggccccagtaaggccgagattacgttc
gatgaccataaaaatggatcgtgcggtgtgtcttacattgcccaggagcctggtaactac
gaggtatccatcaagttcaacgatgagcacatccctgaaagtccctacctggtgccagtc
atcgcgccgtccgacgacgcccgccgcctcactgttctgagccttcaggaatcgggatta
aaagttaaccagccagcctcctttgctataaggttgaatggggcaaaaggcaagattgat
gcaaaggtgcacagcccgtcaggagccgtggaggagtgtcatgtgtctgagctcgagcca
gataagtatgccgttcgcttcatcccccacgagaatggcatccacacgatcgatgtcaag
ttcaacgggagccacgtggttggaagccccttcaaagtgcgcgtcggggatcctggacag
gcggggaaccctgccctggtgtccgcctatggcgcggggctcgaggggggcaccacaggt
atccagtctgaatttttcatcaacaccacccgagcagggccagggacattatctgtcacc
attgaaggaccctccaaggttaaaatggattgccaggaaaccccagaagggtacaaagtc
atgtacacccccatggctcctggaaactacctgattggtgtcaaatatggcgggcccaac
cacattgtgggcagtcctttcaaggccaaggtgacaggccagcgtctggtcagccctggc
tcagccaacgagacctcatctattctggtggagtcggtgaccaggtcatccacagagacc
tgctatagcgccatccccaaggcctcctcggacgccagcaaggtgacctccaagggggca
gggctctcgaaggcctttgtgggccagaagagctccttcttggtggactgcagcaaagcc
ggttccaacatgctgctgattggtgtccatggaccaaccaccccctgcgaagaggtctcc
atgaagcatgtgggcaaccaacaatacaatgtcacatacgttgtcaaggagaagggggat
tatgttctggccgtgaagtggggagaggaacacatccccggcagccccttccacgtcaca
gtgccttaa

DBGET integrated database retrieval system