KEGG   Felis catus (domestic cat): 101081345
Entry
101081345         CDS       T02385                                 
Symbol
SPHK2
Name
(RefSeq) sphingosine kinase 2 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00600  Sphingolipid metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05152  Tuberculosis
Module
fca_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101081345 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101081345 (SPHK2)
   04371 Apelin signaling pathway
    101081345 (SPHK2)
   04020 Calcium signaling pathway
    101081345 (SPHK2)
   04072 Phospholipase D signaling pathway
    101081345 (SPHK2)
   04071 Sphingolipid signaling pathway
    101081345 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101081345 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101081345 (SPHK2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101081345 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 101081345
NCBI-ProteinID: XP_006941093
Ensembl: ENSFCAG00000008657
UniProt: A0A337RZ19
LinkDB
Position
E2:complement(9120328..9128962)
AA seq 660 aa
MNGHLETEEQGDQRPDQELTWSWGHRPRSAPDRAKAMAPPPPPPLAASTPLLHGEFGSFP
ARSSRFALTLTPQALHVQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDAAAAYFCIY
TYPQGRRGGRRRAARTFRVDGAATYEENRAEAQRWATALMCLLRGLPLPGDGEITPELLP
KPPRLLLLVNPLGGRGLAWQWCKTHVLPMISEAGLSFNLIQTERQNHARELVQGLRLSEW
DGIVTVSGDGLLFEVLNGFLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGV
DLLLNCSLLLCRGGSRPLDLMSVTLASGSRCLSFLSVAWGFVSDVDIQSERFRALGSARF
TLGTVLGLATLHTYRGRLSYLPATVEPTSPTPARGLPRAKSELTLAPAPAPAPPVAHSPL
HRSVSDLPLPLPLPQPALTSPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPPLPSP
PSSPKAALLSPITEGVPETLASSGLPPPTPGSPGAVSTRGPHDHLLPPLGTPLPPGWVTL
EGDFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRAALLRLFLAMERGSHFS
LGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCPRREP
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgaatggacaccttgaaacagaggagcagggggatcagaggccagaccaggagctgacc
tggagctggggccacaggcctagaagcgccccggacagggccaaggccatggccccccca
ccgccgccaccattggccgccagcaccccgctcctgcatggcgagtttggctccttcccg
gcccgcagctcccgcttcgccctcactctcacaccacaggccctacacgtacagcggctg
cgcccaaagcctgaagcccggccccggggcggcctcgtcccgctggccgaggtgtccggc
tgctgcaccctgcggagccgcagcccctcggacgcagcggcggcctacttctgcatctac
acctatccgcagggccggcgcgggggccggcgcagagccgcccgcacctttcgggtcgac
ggggcggccacctacgaggagaaccgcgctgaggcccagcgctgggccactgccctcatg
tgtctgctccgtggactgccgctgcctggggacggggaaataacccccgagcttctgcca
aagccaccccgattgctcctattggtcaatccccttggggggcggggcctggcctggcag
tggtgtaagacccacgtgctgcccatgatctccgaagctgggctgtccttcaacctcatc
cagacagaacgacagaaccacgcccgggagctggttcaggggctgaggctgagtgagtgg
gacggcattgtcacggtctccggagacgggctgctgtttgaggtgctgaacggattcctg
gaccgccctgactgggaagaggctgtgaagacgcccgtgggcatcctcccgtgtggctca
ggcaatgccttggccggagctgtgaaccagcatggggggtttgagcctgccctgggtgtg
gacctgctgctcaattgctcgctgctactctgccggggcggcagccgcccgctggacctg
atgtctgtgacgctggcctccggctcccgctgcttgtccttcctgtctgtggcctggggc
ttcgtgtcagacgtggatatccagagcgagcgcttcagggccctgggcagtgcccgcttc
acactgggcacggtgctgggcctcgccacactgcacacctaccgaggacgcctctcctac
ctccctgccaccgtggagcccacctcacccacccctgcccgtggcctgccccgtgccaag
tcagagctgaccctggccccggccccggccccggccccacctgtggcacactcacccctg
catcgttcagtgtctgacctgcccctgcccctgcccctgccccagcccgccctgacctcc
cctggctcgcctgaacccctgcccatcctgtccctcaatggcgggggcccagagttggcc
ggggactggggtggggctggggatgcccccctgtccccagacccaccactgccctcaccg
cctagctcccctaaggcagctttactgtcacccatcaccgagggggtcccagaaacgtta
gcatcctctgggcttccccctcccacccccggctctccgggagccgtctctaccaggggt
ccgcatgaccacctgctccctcctttgggcaccccactccccccaggctgggtgacgctg
gaaggggactttgtgctcatgctggccatctcccctagccacctgggggcagacctggtg
gcagctccccacgcgcgctttgacgacggcctggtgcacctgtgctgggtgcgtggtggc
atctcccgtgctgcgctgctacgcctttttctggccatggagcgaggtagccacttcagc
ctgggctgtccgcagctgggctacgccgcggcccgtgccttccgcctcgagcctctcacg
cctcggggcgtgctcactgtggacggagagcaggtggagtacgggccactgcaggcgcag
atgcatccgggcctcggcacgctgctcactgggcctcccggctgcccgcgtcgggagcct
tga

KEGG   Felis catus (domestic cat): 101084918
Entry
101084918         CDS       T02385                                 
Symbol
SPHK1
Name
(RefSeq) sphingosine kinase 1 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00600  Sphingolipid metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05152  Tuberculosis
Module
fca_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101084918 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101084918 (SPHK1)
   04371 Apelin signaling pathway
    101084918 (SPHK1)
   04020 Calcium signaling pathway
    101084918 (SPHK1)
   04072 Phospholipase D signaling pathway
    101084918 (SPHK1)
   04071 Sphingolipid signaling pathway
    101084918 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101084918 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084918 (SPHK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101084918 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat YegS_C
Other DBs
NCBI-GeneID: 101084918
NCBI-ProteinID: XP_011287697
Ensembl: ENSFCAG00000005455
LinkDB
Position
E1:58196355..58199674
AA seq 387 aa
MDPAGGGGSLLPERCRVLVLLNPRGGKGKALQLFWSHVQPLLAQAGISFTLMLTERRNHA
RELVQGLELGRWDALVVMSGDGLMYEVVNGLMERPDWETAIRKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLEPMNLLSLQTASGLRLFSVLSLSWGFIADVDLE
SEKFRRLGELRFTLGTFLRLAALRVYRGRLAYLPAGRGVPGVPASPAVDRQDQQGPTDAH
LVPLEEPVPAHWTVVPEQDFVLVLALLHSHLGSEMFAAPMGRSAAGTMHLFYVRAGVSRA
TLLRLFLAMEKGKHLEQACPYLVYAPVVAFRLEPKDGKGVFAADGELLVSEAVQGQVHAD
YIWMVSGCVEPPPGQKPRRGSPPEKPL
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggatccagcgggaggcggcgggagcctgctgcccgagcggtgccgcgtgctggtcctg
ttaaacccgcgcggaggcaagggcaaggcgctgcagctcttctggagccacgtgcagccc
ctgctggcccaggccggcatctccttcacgctgatgctcactgagcgtcggaaccacgct
cgggagctggtgcaggggttggagctggggcgctgggacgccctggtggtcatgtctgga
gacgggctgatgtacgaggtggtgaacgggctcatggagcggcccgactgggagactgcc
atccggaagcccctgtgtagcctcccggctggctccggcaacgccctggcagcttctttg
aaccattatgccggctatgagcaggtgaccaacgaggacctcttgaccaactgcaccctg
ctgctgtgccgccggctgctggagcccatgaacctcctgtcactgcagaccgcctcgggg
ctgcgcctcttctccgtgcttagcctgtcttggggcttcatcgctgatgtggatctggag
agcgagaagtttcggcgcctcggggagctccgcttcactctgggcaccttcctgcgcctg
gcggcgctgcgcgtgtaccggggccgactggcctacctgcccgcaggaaggggggtcccc
ggggtgcccgcctcccctgcggtggaccggcaggaccagcagggccctacggacgcgcac
ctcgtacccctggaggagccggtgcccgcgcactggacggtggtgccggagcaggacttc
gtgctggtgctggcgttgctgcactcgcacctgggcagcgagatgttcgctgccccgatg
ggccgctctgccgccggcaccatgcacctgttctacgtgcgggcgggcgtgtctcgggcc
acgctgctgcgcctcttcctggccatggagaaggggaagcacttggagcaggcctgtccc
tacttggtgtacgcgcccgtggtcgccttccgcctggagcccaaggatgggaagggtgtg
tttgccgccgacggggagttgttggtcagcgaggctgtgcaaggccaggtgcacgcggac
tacatctggatggtcagtggctgcgtggagcccccacccggccagaagcctcggcgggga
tcacctccagaaaagcccttatga

DBGET integrated database retrieval system