Felis catus (domestic cat): 101081371 Help Entry 101081371         CDS       T02385                                  Name (RefSeq) interferon alpha-like   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101081371    04151 PI3K-Akt signaling pathway     101081371   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101081371  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101081371  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101081371    04621 NOD-like receptor signaling pathway     101081371    04622 RIG-I-like receptor signaling pathway     101081371    04623 Cytosolic DNA-sensing pathway     101081371    04650 Natural killer cell mediated cytotoxicity     101081371  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101081371   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101081371    05161 Hepatitis B     101081371    05160 Hepatitis C     101081371    05171 Coronavirus disease - COVID-19     101081371    05164 Influenza A     101081371    05162 Measles     101081371    05168 Herpes simplex virus 1 infection     101081371    05163 Human cytomegalovirus infection     101081371    05167 Kaposi sarcoma-associated herpesvirus infection     101081371    05169 Epstein-Barr virus infection     101081371    05165 Human papillomavirus infection     101081371   09171 Infectious disease: bacterial    05152 Tuberculosis     101081371   09163 Immune disease    05320 Autoimmune thyroid disease     101081371   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101081371   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101081371  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     101081371 Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    101081371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  101081371 NCBI-ProteinID:  XP_004001317 Ensembl:  ENSFCAG00000022104 UniProt:  A0A7R8C3W1 LinkDB All DBs Position D4:complement(47727660..47728306) Genome browser AA seq 193 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVVQEVGEGEAPLTNEDIHPEDSLLRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY SSTALQKRLRSEK NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg catgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggacatt catcccgaggactccctcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tcgtcaacagccttgcagaaaagattgaggagcgagaaatga

Felis catus (domestic cat): 101088440 Help Entry 101088440         CDS       T02385                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101088440    04151 PI3K-Akt signaling pathway     101088440   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101088440  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101088440  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101088440    04621 NOD-like receptor signaling pathway     101088440    04622 RIG-I-like receptor signaling pathway     101088440    04623 Cytosolic DNA-sensing pathway     101088440    04650 Natural killer cell mediated cytotoxicity     101088440  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101088440   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101088440    05161 Hepatitis B     101088440    05160 Hepatitis C     101088440    05171 Coronavirus disease - COVID-19     101088440    05164 Influenza A     101088440    05162 Measles     101088440    05168 Herpes simplex virus 1 infection     101088440    05163 Human cytomegalovirus infection     101088440    05167 Kaposi sarcoma-associated herpesvirus infection     101088440    05169 Epstein-Barr virus infection     101088440    05165 Human papillomavirus infection     101088440   09171 Infectious disease: bacterial    05152 Tuberculosis     101088440   09163 Immune disease    05320 Autoimmune thyroid disease     101088440   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101088440   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101088440  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     101088440 Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    101088440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MnmE_helical Motif Other DBs NCBI-GeneID:  101088440 NCBI-ProteinID:  XP_003995570 Ensembl:  ENSFCAG00000023458 UniProt:  M3WZS7 LinkDB All DBs Position D4:complement(47654166..47654717) Genome browser AA seq 183 aa AA seqDB search MALSISVLLALVMLCSSPAYSLDCDLRPSNPETFTLLSQMERVSILSCLKDRTDFNFPQI LVAGNQLEKTQVTAVVHEMLQQIFNLFSKSDSFVAWDEMLLDRFLVGLYQQLDDLETCLR EEMNMEQLPLGNENSRLAVKRYFQGISLYLKEKEYSHCAWEVVRVEIRRCLLVINKLTGT FRK NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggctctctcaatctctgtgctgttggctctggtgatgctgtgctccagccccgcctac tctctggactgtgacctgcgtccgagcaatccagaaaccttcacacttttgagtcaaatg gagagagtctccattctgtcctgtctgaaggacaggactgacttcaactttcctcagata cttgtggctgggaaccagcttgagaagacacaagtgacagctgtcgtgcatgagatgctc cagcagatcttcaacctcttcagcaaaagcgactcctttgtggcttgggatgagatgctt ctggacagattccttgttggactttaccaacagctggatgacctggagacgtgtttgagg gaggaaatgaacatggaacagctacccctgggaaatgagaactccagactggctgtgaag agatacttccaaggaatcagtctctatcttaaagagaaagaatacagccactgtgcctgg gaggttgtcagggtagaaatcagaagatgcttgctcgtcattaacaagctcacagggaca ttcaggaaataa

Felis catus (domestic cat): 111557596 Help Entry 111557596         CDS       T02385                                  Name (RefSeq) interferon alpha-like   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111557596    04151 PI3K-Akt signaling pathway     111557596   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111557596  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111557596  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111557596    04621 NOD-like receptor signaling pathway     111557596    04622 RIG-I-like receptor signaling pathway     111557596    04623 Cytosolic DNA-sensing pathway     111557596    04650 Natural killer cell mediated cytotoxicity     111557596  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111557596   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111557596    05161 Hepatitis B     111557596    05160 Hepatitis C     111557596    05171 Coronavirus disease - COVID-19     111557596    05164 Influenza A     111557596    05162 Measles     111557596    05168 Herpes simplex virus 1 infection     111557596    05163 Human cytomegalovirus infection     111557596    05167 Kaposi sarcoma-associated herpesvirus infection     111557596    05169 Epstein-Barr virus infection     111557596    05165 Human papillomavirus infection     111557596   09171 Infectious disease: bacterial    05152 Tuberculosis     111557596   09163 Immune disease    05320 Autoimmune thyroid disease     111557596   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111557596   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111557596  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     111557596 Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    111557596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  111557596 NCBI-ProteinID:  XP_023099037 LinkDB All DBs Position D4:47789721..47790507 Genome browser AA seq 193 aa AA seqDB search MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSPKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTLLEEFCTGLDRQLTRL EACVVQEVGEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY SSTALQKRLRSEK NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc tctctgggttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc ttcccccaggacgtgtttggtggagaccagtcccccaaggcccaagccctctcggtggtg cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctgacgaacgaggacatt catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tcgtcaacagccttgcagaaaagattaaggagcgagaaatga

Felis catus (domestic cat): 493648 Help Entry 493648            CDS       T02385                                  Symbol IFNA8 Name (RefSeq) interferon alpha-8 precursor   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493648 (IFNA8)    04151 PI3K-Akt signaling pathway     493648 (IFNA8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493648 (IFNA8)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493648 (IFNA8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493648 (IFNA8)    04621 NOD-like receptor signaling pathway     493648 (IFNA8)    04622 RIG-I-like receptor signaling pathway     493648 (IFNA8)    04623 Cytosolic DNA-sensing pathway     493648 (IFNA8)    04650 Natural killer cell mediated cytotoxicity     493648 (IFNA8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493648 (IFNA8)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493648 (IFNA8)    05161 Hepatitis B     493648 (IFNA8)    05160 Hepatitis C     493648 (IFNA8)    05171 Coronavirus disease - COVID-19     493648 (IFNA8)    05164 Influenza A     493648 (IFNA8)    05162 Measles     493648 (IFNA8)    05168 Herpes simplex virus 1 infection     493648 (IFNA8)    05163 Human cytomegalovirus infection     493648 (IFNA8)    05167 Kaposi sarcoma-associated herpesvirus infection     493648 (IFNA8)    05169 Epstein-Barr virus infection     493648 (IFNA8)    05165 Human papillomavirus infection     493648 (IFNA8)   09171 Infectious disease: bacterial    05152 Tuberculosis     493648 (IFNA8)   09163 Immune disease    05320 Autoimmune thyroid disease     493648 (IFNA8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493648 (IFNA8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     493648 (IFNA8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     493648 (IFNA8) Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    493648 (IFNA8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  493648 NCBI-ProteinID:  NP_001009193 Ensembl:  ENSFCAG00000007773 UniProt:  Q863J0 LinkDB All DBs Position D4:complement(47683815..47684381) Genome browser AA seq 189 aa AA seqDB search MALPSSFLVSLVALGCNSVCSLCCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTA LQKRLRSEK NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtgtccctggtggcgctgggctgcaactccgtctgc tctctttgctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct tgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattattcatcaacagcc ttgcagaaaagattaaggagcgagaaatga

Felis catus (domestic cat): 493653 Help Entry 493653            CDS       T02385                                  Symbol IFNA7 Name (RefSeq) interferon alpha precursor   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493653 (IFNA7)    04151 PI3K-Akt signaling pathway     493653 (IFNA7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493653 (IFNA7)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493653 (IFNA7)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493653 (IFNA7)    04621 NOD-like receptor signaling pathway     493653 (IFNA7)    04622 RIG-I-like receptor signaling pathway     493653 (IFNA7)    04623 Cytosolic DNA-sensing pathway     493653 (IFNA7)    04650 Natural killer cell mediated cytotoxicity     493653 (IFNA7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493653 (IFNA7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493653 (IFNA7)    05161 Hepatitis B     493653 (IFNA7)    05160 Hepatitis C     493653 (IFNA7)    05171 Coronavirus disease - COVID-19     493653 (IFNA7)    05164 Influenza A     493653 (IFNA7)    05162 Measles     493653 (IFNA7)    05168 Herpes simplex virus 1 infection     493653 (IFNA7)    05163 Human cytomegalovirus infection     493653 (IFNA7)    05167 Kaposi sarcoma-associated herpesvirus infection     493653 (IFNA7)    05169 Epstein-Barr virus infection     493653 (IFNA7)    05165 Human papillomavirus infection     493653 (IFNA7)   09171 Infectious disease: bacterial    05152 Tuberculosis     493653 (IFNA7)   09163 Immune disease    05320 Autoimmune thyroid disease     493653 (IFNA7)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493653 (IFNA7)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     493653 (IFNA7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     493653 (IFNA7) Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    493653 (IFNA7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  493653 NCBI-ProteinID:  NP_001009197 Ensembl:  ENSFCAG00000023542 UniProt:  P35849 LinkDB All DBs Position D4:47798892..47799638 Genome browser AA seq 194 aa AA seqDB search MALPSSFLVALVALGCNSVCVLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY YSSTALQKRLRSEK NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc gtgctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc ctgggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct tggaacaccaccctcctggaggaattttgcacgggacttgatcggcagctgacccgcctg gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacgaacgaggacatt catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tattcatcaacagccttgcagaaaagattaaggagcgagaaatga

Felis catus (domestic cat): 493840 Help Entry 493840            CDS       T02385                                  Symbol IFNA5 Name (RefSeq) LOW QUALITY PROTEIN: interferon alpha-5   KO K05414   interferon alpha Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04151   PI3K-Akt signaling pathway fca04217   Necroptosis fca04620   Toll-like receptor signaling pathway fca04621   NOD-like receptor signaling pathway fca04622   RIG-I-like receptor signaling pathway fca04623   Cytosolic DNA-sensing pathway fca04630   JAK-STAT signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04936   Alcoholic liver disease fca05152   Tuberculosis fca05160   Hepatitis C fca05161   Hepatitis B fca05162   Measles fca05163   Human cytomegalovirus infection fca05164   Influenza A fca05165   Human papillomavirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05168   Herpes simplex virus 1 infection fca05169   Epstein-Barr virus infection fca05170   Human immunodeficiency virus 1 infection fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05320   Autoimmune thyroid disease fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     493840 (IFNA5)    04151 PI3K-Akt signaling pathway     493840 (IFNA5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     493840 (IFNA5)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     493840 (IFNA5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     493840 (IFNA5)    04621 NOD-like receptor signaling pathway     493840 (IFNA5)    04622 RIG-I-like receptor signaling pathway     493840 (IFNA5)    04623 Cytosolic DNA-sensing pathway     493840 (IFNA5)    04650 Natural killer cell mediated cytotoxicity     493840 (IFNA5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     493840 (IFNA5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     493840 (IFNA5)    05161 Hepatitis B     493840 (IFNA5)    05160 Hepatitis C     493840 (IFNA5)    05171 Coronavirus disease - COVID-19     493840 (IFNA5)    05164 Influenza A     493840 (IFNA5)    05162 Measles     493840 (IFNA5)    05168 Herpes simplex virus 1 infection     493840 (IFNA5)    05163 Human cytomegalovirus infection     493840 (IFNA5)    05167 Kaposi sarcoma-associated herpesvirus infection     493840 (IFNA5)    05169 Epstein-Barr virus infection     493840 (IFNA5)    05165 Human papillomavirus infection     493840 (IFNA5)   09171 Infectious disease: bacterial    05152 Tuberculosis     493840 (IFNA5)   09163 Immune disease    05320 Autoimmune thyroid disease     493840 (IFNA5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     493840 (IFNA5)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     493840 (IFNA5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:fca04052]     493840 (IFNA5) Cytokines and growth factors [BR:fca04052]  Cytokines   Interferons    493840 (IFNA5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  493840 NCBI-ProteinID:  XP_023099036 LinkDB All DBs Position D4:complement(47706575..47707186) Genome browser AA seq 194 aa AA seqDB search MALPSSFLVALVALGCNSVLLFACDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTPPEGILARTDRQLTRL EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY YSSIALQKRLRSEK NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtcttg ctctttgcttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc cttggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct tggaacaccacccctcctgagggaattcttgcacggactgatcggcagctgacccgcctg gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacaaacgaggacatt catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat tattcatcaatagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system