KEGG   Felis catus (domestic cat): 101081371
Entry
101081371         CDS       T02385                                 
Name
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101081371
   04151 PI3K-Akt signaling pathway
    101081371
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081371
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101081371
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101081371
   04621 NOD-like receptor signaling pathway
    101081371
   04622 RIG-I-like receptor signaling pathway
    101081371
   04623 Cytosolic DNA-sensing pathway
    101081371
   04650 Natural killer cell mediated cytotoxicity
    101081371
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081371
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101081371
   05161 Hepatitis B
    101081371
   05160 Hepatitis C
    101081371
   05171 Coronavirus disease - COVID-19
    101081371
   05164 Influenza A
    101081371
   05162 Measles
    101081371
   05168 Herpes simplex virus 1 infection
    101081371
   05163 Human cytomegalovirus infection
    101081371
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081371
   05169 Epstein-Barr virus infection
    101081371
   05165 Human papillomavirus infection
    101081371
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101081371
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101081371
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101081371
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101081371
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101081371
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   101081371
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 101081371
NCBI-ProteinID: XP_004001317
Ensembl: ENSFCAG00000022104
UniProt: A0A7R8C3W1
LinkDB
Position
D4:complement(47727660..47728306)
AA seq 193 aa
MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDIHPEDSLLRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
SSTALQKRLRSEK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
catgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggacatt
catcccgaggactccctcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tcgtcaacagccttgcagaaaagattgaggagcgagaaatga

KEGG   Felis catus (domestic cat): 101088440
Entry
101088440         CDS       T02385                                 
Name
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101088440
   04151 PI3K-Akt signaling pathway
    101088440
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101088440
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101088440
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101088440
   04621 NOD-like receptor signaling pathway
    101088440
   04622 RIG-I-like receptor signaling pathway
    101088440
   04623 Cytosolic DNA-sensing pathway
    101088440
   04650 Natural killer cell mediated cytotoxicity
    101088440
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088440
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101088440
   05161 Hepatitis B
    101088440
   05160 Hepatitis C
    101088440
   05171 Coronavirus disease - COVID-19
    101088440
   05164 Influenza A
    101088440
   05162 Measles
    101088440
   05168 Herpes simplex virus 1 infection
    101088440
   05163 Human cytomegalovirus infection
    101088440
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088440
   05169 Epstein-Barr virus infection
    101088440
   05165 Human papillomavirus infection
    101088440
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088440
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101088440
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101088440
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101088440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101088440
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   101088440
SSDB
Motif
Pfam: Interferon MnmE_helical
Other DBs
NCBI-GeneID: 101088440
NCBI-ProteinID: XP_003995570
Ensembl: ENSFCAG00000023458
UniProt: M3WZS7
LinkDB
Position
D4:complement(47654166..47654717)
AA seq 183 aa
MALSISVLLALVMLCSSPAYSLDCDLRPSNPETFTLLSQMERVSILSCLKDRTDFNFPQI
LVAGNQLEKTQVTAVVHEMLQQIFNLFSKSDSFVAWDEMLLDRFLVGLYQQLDDLETCLR
EEMNMEQLPLGNENSRLAVKRYFQGISLYLKEKEYSHCAWEVVRVEIRRCLLVINKLTGT
FRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggctctctcaatctctgtgctgttggctctggtgatgctgtgctccagccccgcctac
tctctggactgtgacctgcgtccgagcaatccagaaaccttcacacttttgagtcaaatg
gagagagtctccattctgtcctgtctgaaggacaggactgacttcaactttcctcagata
cttgtggctgggaaccagcttgagaagacacaagtgacagctgtcgtgcatgagatgctc
cagcagatcttcaacctcttcagcaaaagcgactcctttgtggcttgggatgagatgctt
ctggacagattccttgttggactttaccaacagctggatgacctggagacgtgtttgagg
gaggaaatgaacatggaacagctacccctgggaaatgagaactccagactggctgtgaag
agatacttccaaggaatcagtctctatcttaaagagaaagaatacagccactgtgcctgg
gaggttgtcagggtagaaatcagaagatgcttgctcgtcattaacaagctcacagggaca
ttcaggaaataa

KEGG   Felis catus (domestic cat): 111557596
Entry
111557596         CDS       T02385                                 
Name
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111557596
   04151 PI3K-Akt signaling pathway
    111557596
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111557596
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111557596
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111557596
   04621 NOD-like receptor signaling pathway
    111557596
   04622 RIG-I-like receptor signaling pathway
    111557596
   04623 Cytosolic DNA-sensing pathway
    111557596
   04650 Natural killer cell mediated cytotoxicity
    111557596
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111557596
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111557596
   05161 Hepatitis B
    111557596
   05160 Hepatitis C
    111557596
   05171 Coronavirus disease - COVID-19
    111557596
   05164 Influenza A
    111557596
   05162 Measles
    111557596
   05168 Herpes simplex virus 1 infection
    111557596
   05163 Human cytomegalovirus infection
    111557596
   05167 Kaposi sarcoma-associated herpesvirus infection
    111557596
   05169 Epstein-Barr virus infection
    111557596
   05165 Human papillomavirus infection
    111557596
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111557596
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111557596
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111557596
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    111557596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    111557596
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   111557596
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 111557596
NCBI-ProteinID: XP_023099037
LinkDB
Position
D4:47789721..47790507
AA seq 193 aa
MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSPKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
SSTALQKRLRSEK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
tctctgggttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgtttggtggagaccagtcccccaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctgacgaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tcgtcaacagccttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493648
Entry
493648            CDS       T02385                                 
Symbol
IFNA8
Name
(RefSeq) interferon alpha-8 precursor
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493648 (IFNA8)
   04151 PI3K-Akt signaling pathway
    493648 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493648 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493648 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493648 (IFNA8)
   04621 NOD-like receptor signaling pathway
    493648 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    493648 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    493648 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    493648 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493648 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493648 (IFNA8)
   05161 Hepatitis B
    493648 (IFNA8)
   05160 Hepatitis C
    493648 (IFNA8)
   05171 Coronavirus disease - COVID-19
    493648 (IFNA8)
   05164 Influenza A
    493648 (IFNA8)
   05162 Measles
    493648 (IFNA8)
   05168 Herpes simplex virus 1 infection
    493648 (IFNA8)
   05163 Human cytomegalovirus infection
    493648 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493648 (IFNA8)
   05169 Epstein-Barr virus infection
    493648 (IFNA8)
   05165 Human papillomavirus infection
    493648 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493648 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493648 (IFNA8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493648 (IFNA8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493648 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493648 (IFNA8)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493648 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 493648
NCBI-ProteinID: NP_001009193
Ensembl: ENSFCAG00000007773
UniProt: Q863J0
LinkDB
Position
D4:complement(47683815..47684381)
AA seq 189 aa
MALPSSFLVSLVALGCNSVCSLCCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTA
LQKRLRSEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtgtccctggtggcgctgggctgcaactccgtctgc
tctctttgctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc
atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct
tgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattattcatcaacagcc
ttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493653
Entry
493653            CDS       T02385                                 
Symbol
IFNA7
Name
(RefSeq) interferon alpha precursor
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493653 (IFNA7)
   04151 PI3K-Akt signaling pathway
    493653 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493653 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493653 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493653 (IFNA7)
   04621 NOD-like receptor signaling pathway
    493653 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    493653 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    493653 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    493653 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493653 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493653 (IFNA7)
   05161 Hepatitis B
    493653 (IFNA7)
   05160 Hepatitis C
    493653 (IFNA7)
   05171 Coronavirus disease - COVID-19
    493653 (IFNA7)
   05164 Influenza A
    493653 (IFNA7)
   05162 Measles
    493653 (IFNA7)
   05168 Herpes simplex virus 1 infection
    493653 (IFNA7)
   05163 Human cytomegalovirus infection
    493653 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493653 (IFNA7)
   05169 Epstein-Barr virus infection
    493653 (IFNA7)
   05165 Human papillomavirus infection
    493653 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493653 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493653 (IFNA7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493653 (IFNA7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493653 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493653 (IFNA7)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493653 (IFNA7)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 493653
NCBI-ProteinID: NP_001009197
Ensembl: ENSFCAG00000023542
UniProt: P35849
LinkDB
Position
D4:47798892..47799638
AA seq 194 aa
MALPSSFLVALVALGCNSVCVLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
YSSTALQKRLRSEK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
gtgctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattttgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacgaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tattcatcaacagccttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493840
Entry
493840            CDS       T02385                                 
Symbol
IFNA5
Name
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-5
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  JAK-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04936  Alcoholic liver disease
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    493840 (IFNA5)
   04151 PI3K-Akt signaling pathway
    493840 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493840 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493840 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493840 (IFNA5)
   04621 NOD-like receptor signaling pathway
    493840 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    493840 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    493840 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    493840 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493840 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493840 (IFNA5)
   05161 Hepatitis B
    493840 (IFNA5)
   05160 Hepatitis C
    493840 (IFNA5)
   05171 Coronavirus disease - COVID-19
    493840 (IFNA5)
   05164 Influenza A
    493840 (IFNA5)
   05162 Measles
    493840 (IFNA5)
   05168 Herpes simplex virus 1 infection
    493840 (IFNA5)
   05163 Human cytomegalovirus infection
    493840 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493840 (IFNA5)
   05169 Epstein-Barr virus infection
    493840 (IFNA5)
   05165 Human papillomavirus infection
    493840 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493840 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493840 (IFNA5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493840 (IFNA5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    493840 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493840 (IFNA5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493840 (IFNA5)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 493840
NCBI-ProteinID: XP_023099036
LinkDB
Position
D4:complement(47706575..47707186)
AA seq 194 aa
MALPSSFLVALVALGCNSVLLFACDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTPPEGILARTDRQLTRL
EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
YSSIALQKRLRSEK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtcttg
ctctttgcttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
cttggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct
tggaacaccacccctcctgagggaattcttgcacggactgatcggcagctgacccgcctg
gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacaaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tattcatcaatagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system