KEGG   Felis catus (domestic cat): 101081420
Entry
101081420         CDS       T02385                                 
Symbol
PIP5K1B
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 beta isoform X3
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05231  Choline metabolism in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101081420 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101081420 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    101081420 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081420 (PIP5K1B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081420 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101081420 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101081420 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101081420 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101081420 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081420 (PIP5K1B)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     101081420 (PIP5K1B)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101081420 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    101081420 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    101081420 (PIP5K1B)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 101081420
NCBI-ProteinID: XP_019671300
Ensembl: ENSFCAG00000008812
LinkDB
Position
D4:11291653..11611782
AA seq 551 aa
MSSAAENGDAASGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPDRDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKEKEEENPQNVPDAKRSGMQ
KVLYSTAMESIQGPGKPGDGIITENPDTMGGIPAKSHKGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKGEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHCPHDRTTLYSNSKGLPSSSTFTLEEGTIYLTSESNALEMQDDNASVLDVYL
KLQNVCFAKMR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgtcgtctgctgctgaaaatggagatgcagcatctggaaaacagaacgaagaaaaaact
tacaaaaagactgcatcatctgctatcaaaggtgctattcagctggggataggatacacc
gtgggtaatctcacttccaagccggatagagatgttctcatgcaagacttttacgtggtg
gaaagtgtgttcctacccagtgaagggagcaatctgaccccagcacatcattacccagac
ttcaggtttaagacctatgctccactggcgttccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgtagtgaacctctaatagagctgtccaacccc
ggagccagtggatccttgttttttgtgaccagcgatgatgaatttatcatcaaaaccgta
cagcataaagaagctgagttccttcagaagctactgccaggctattacatgaatttgaac
cagaatccaaggactcttttgccaaaattttacggactgtactgcatgcaatcggggggc
attaacatcaggatcgtggtaatgaacaacgtcttaccgcgctccatgagaatgcacttc
acgtatgacctgaaaggctccacgtacaagcgaagagcttcccgaaaagagagggagaaa
tccaaccccaccttcaaggacttggatttcctgcaggacatgcacgaagggttatatttt
gacacagaaacttacaacgcgctcatgaaaacacttcagagagactgccgggtgctagaa
agcttcaaaatcatggactacagccttttgctgggaatccacatcttggaccattccctc
aaagagaaagaagaggagaacccacaaaacgtgcctgatgctaaacggtcggggatgcag
aaggtcctctattcgacagcaatggaatccatccagggtccagggaaaccaggagacggg
atcatcacagagaacccggacacaatgggaggcattccagctaaaagccataagggagaa
aaactacttttgtttatgggcattattgacattctgcaatcatataggttaatgaagaag
ttagaacattcctggaaagcgcttgtttatgatggggatactgtttcagttcatcgacca
agcttttatgctgacagatttctaaagtttatgaattccagagttttcaagaaaattcaa
gctttgaaggcctcaccttctaaaaaacggtgcaactccatcgctgccctgaaggcaacc
tcccaagagatcgtgtcctcaattagccaggaatggaagggtgagaagcgggatctgctg
accgaggggcagagtttcagcagccttgacgaggaagccctgggatcccgacacaggccg
gacctggtgcctagcactccttcactctttgaagctgcttccttggcaaccacgatttct
tcttcttccttatatgtcaatgaacattgtccacacgacaggactacgctctattcaaac
agtaaagggttaccttccagttcaacatttaccttggaagaggggaccatctacttgact
tcggagtccaatgctctggaaatgcaggatgataatgcctctgtgctggatgtctattta
aagcttcaaaatgtgtgttttgccaaaatgagataa

KEGG   Felis catus (domestic cat): 101097791
Entry
101097791         CDS       T02385                                 
Symbol
PIP5K1C
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase type-1 gamma isoform X1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05231  Choline metabolism in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101097791 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101097791 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    101097791 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101097791 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097791 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101097791 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101097791 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101097791 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101097791 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101097791 (PIP5K1C)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     101097791 (PIP5K1C)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101097791 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    101097791 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    101097791 (PIP5K1C)
SSDB
Motif
Pfam: PIP5K Hemopexin Toxin_33
Other DBs
NCBI-GeneID: 101097791
NCBI-ProteinID: XP_023099515
Ensembl: ENSFCAG00000007139
LinkDB
Position
A2:complement(2846500..2896171)
AA seq 697 aa
MELEVPDEAESAEAGAVTSEASWASESGAAAGLAQKKMAPSEAPSMTGQLGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSIPTYKDLDFIQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQQERERQAEGAQSTAGEKRPLGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGASLAVKPLGPTAAFSASQIP
SEREDAQYDLRGARSYPTLEDEGAHSLLPAGRPDLLPCTPPSFEEATTASIATTLSSTSL
SIPERSPSETSEQPRYRRRTQSSGQDGRSQEETHVEEDLQQVTVQVESACSVEIVVPKEE
DAGVEASPACASAAAEAETASQASEPASQASDEEDTPATDIYFFTDGRYWIYSPRHRRLR
AVTLSSSGTPADERSWVYSPLHYSAQVHPASDGESDT
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggagctggaggtgccggacgaggcggagagcgccgaggcgggggccgtgacctcggag
gcgtcctgggcctcggagagcggggcggcggcaggcttggcccagaagaagatggccccg
tcggaggccccgtcgatgactggacagctgggccccggccacgggaagaagttgggtcat
cggggcgtggacgcatctggcgaaaccacctacaagaagaccacgtcctccaccctgaag
ggggccatccagctgggcatcggctacaccgtgggcaacctgagctccaagccagagcgt
gacgtgctcatgcaggacttctacgtcgtggagagcatcttcttccccagtgaaggcagc
aacctcacccccgcccaccacttccaggacttcaggttcaagacctacgcacctgtcgcc
ttccgctacttccgggaactcttcgggatccgaccggatgattacttgtactcgctgtgc
aacgagccactgatcgagctgtccaaccccggcgccagcggctccctgttctacgtcacc
agtgacgacgagttcatcatcaagacggtgatgcacaaggaggccgagttcctgcagaag
ctgttacccggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttt
tacgggctgtactgcgtgcagtcgggcggcaagaacatccgcgtggtggtcatgaacaac
atcctgccgcgcgttgtcaagatgcacctcaagttcgacctcaagggctccacgtacaag
cggcgggccagcaagaaagagaaggagaagagcattcccacctacaaggacctggacttc
atccaggacatgcccgaggggctcctgctggacgcagacaccttctccgccctcgtcaag
acgctgcaacgggactgcctggtgctggagagcttcaagatcatggactacagcctgctc
ctgggcgtgcacaacatcgaccagcaggagcgggagcggcaggccgagggcgcccagagc
accgcgggcgagaagcggccgctgggccagaaggccctctactccacggccatggagtcc
atccagggcggggccgcgcgcggggaggccatcgagtcggacgacacgatgggcgggatt
cccgccgtgaacggccgaggggagcgcctcttgctgcatattggcatcattgacattctg
cagtcgtacaggttcatcaagaagctggaacacacctggaaggctcttgtccacgacggg
gacaccgtctctgtccaccggcccagcttctacgcagagcgcttcttcaagttcatgagc
aacacggttttccggaagaactcctctctgaagtcctccccgtccaagaagggccgtggt
gcgtcattggctgtcaagcccctggggcccacggccgccttctcggccagccagatcccc
agcgagcgggaagatgcccagtatgaccttcggggggcccgcagctaccccacgctggag
gacgaaggcgcccacagcctcctccccgcaggccggcccgacctcctgccctgcacgccg
ccatcctttgaggaggccaccaccgcctccatcgccacaaccctgtcttccacgtccctc
tccatcccagagcgatctccctcggagacctcagagcagccacggtaccggcggcgcaca
cagtcttccggacaggatggccggtcccaagaggagacacacgtggaggaggacctgcag
caggtcacggtgcaggtggagtccgcgtgcagcgtggagatcgtggtccccaaggaggaa
gacgcgggggtggaggcttccccagcctgtgcctctgctgctgccgaagcagaaacggcc
agccaggcctcggagcccgccagccaggcctcagatgaggaggacacgcccgccactgac
atctactttttcaccgatgggaggtactggatttactctccccggcatcgccgactgcgg
gccgtgacgctgagctcctcagggactcccgccgacgagaggagctgggtgtactccccg
ctgcactatagcgcgcaggtccacccagcctccgacggcgagagcgacacataa

KEGG   Felis catus (domestic cat): 101098154
Entry
101098154         CDS       T02385                                 
Symbol
PIP5K1A
Name
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04070  Phosphatidylinositol signaling system
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04510  Focal adhesion
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05231  Choline metabolism in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101098154 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101098154 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    101098154 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101098154 (PIP5K1A)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101098154 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101098154 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101098154 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101098154 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101098154 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101098154 (PIP5K1A)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     101098154 (PIP5K1A)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101098154 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    101098154 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    101098154 (PIP5K1A)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 101098154
NCBI-ProteinID: XP_006935178
Ensembl: ENSFCAG00000005563
LinkDB
Position
C1:106285115..106320768
AA seq 562 aa
MASASSGPSSVGFSSADPGVPSCASSSGFNFLCCGVSRKRASGIKRPMASEVPYASGMPM
KKIGHRGVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFF
PSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGS
LFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRI
VVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMY
NALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLGNETQYSVDTRRPAPQKALYS
TAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKA
LVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGPSGNSCI
TYQTSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEKISEVTTIPDPYFSPVVGETL
QMQTTSSILLEKPEVAESEFTH
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcgtcggcctcctcagggccgtcgtcggtcgggttttcatccgcggatcccggcgtc
ccttcctgcgcctcgtcctcaggtttcaactttctgtgctgtggggtcagccgtaagaga
gcatctggaatcaagagacccatggcatctgaggtgccatatgcctctggcatgcccatg
aagaaaataggccaccgaggtgttgattcctcaggagagacgacatataaaaagacaacc
tcatctgccttgaaaggtgccatccagttaggcattactcacactgtgggaagcctgagt
accaaaccagagcgtgatgtcctcatgcaagacttctatgtggtggagagtatcttcttt
cccagtgaagggagcaacttgactcctgctcatcactacaatgactttcgcttcaaaacc
tatgcacctgttgccttccgttactttcgggagttatttggtatccggcctgatgattac
ttgtactccctctgcagtgagccactgattgaactctgcagctctggggccagtggttcc
ctcttctatgtgtccagtgacgatgaattcatcattaaaacggtccagcataaagaggcg
gagtttctgcagaagctgcttccaggatactacatgaacctcaatcagaaccctcgcact
ttgctgcctaaattctatggactgtactgtgtgcaggcaggtggaaagaacattcgaatt
gtggtgatgaacaatctcttaccacggtcagtcaagatgcacatcaaatatgacctcaag
ggctcaacctacaaacggcgggcttcccaaaaagagcgagagaagcctttacccaccttt
aaagacctggacttcttacaagacattccagatggtctttttttggatgctgatatgtac
aatgctctatgtaagaccttacagcgtgactgtttggtgctgcagagcttcaagataatg
gactatagcctcttgatgtcaatccataacatagatcatgcccaacgagagcccttaggc
aatgaaacacagtattcagttgatactcgcagaccagccccccaaaaggctctctattcc
acagctatggaatctatccagggcgaggctcggcgaggtggcactatggagactgatgac
catatgggtggcatcccggcccgcaatagtaaaggggaaaggctgctgctttatattggg
atcattgacattcttcagtcttacaggtttgttaagaagttggagcactcttggaaagct
ctggtacatgatggggacaccgtatcggtgcatcggccaggcttctatgctgaacggttc
caacgcttcatgtgcaacacagtgttcaagaagatacccttgaagccctctccttccaaa
aagtttcggtctggctcatctttctctcggcgagcaggccccagcggcaactcctgcatt
acttaccagacatcggtctctggggagcacaaggcacaagtgacaacaaaggcggaagtg
gagccaggcgtccacttgggtcgtcctgatgttttacctcagactccacctttggagaaa
atcagtgaggtcacgactattcctgacccctatttctcacctgtagttggagagacttta
caaatgcaaactacaagttcaatcctcttggaaaagcctgaagttgcagagtcagagttc
acccattga

DBGET integrated database retrieval system