KEGG   Felis catus (domestic cat): 101081653
Entry
101081653         CDS       T02385                                 
Symbol
PKN2
Name
(RefSeq) serine/threonine-protein kinase N2 isoform X1
  KO
K23691  serine/threonine-protein kinase N2 [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101081653 (PKN2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101081653 (PKN2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101081653 (PKN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101081653 (PKN2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101081653 (PKN2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKN family
   101081653 (PKN2)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like Uds1 C2 Haspin_kinase ABC1 ARGLU
Other DBs
NCBI-GeneID: 101081653
NCBI-ProteinID: XP_011283188
Ensembl: ENSFCAG00000024813
LinkDB
Position
C1:75401135..75530263
AA seq 983 aa
MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTVVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDVTDCPR
TPDTPSSDPRCSTSNNRLMALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNELPKNHPKSSIIIEELSLVA
SPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWSP
SETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQKF
TLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNP
VIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQASVP
ATVPVVDVRIPELAPPAGDSTVTKLDFDLEPEPPPAPPRDSSLGEIDESAELRDSDTPRQ
DSEAVFAIENDRNSILPKSQSEYEPDIPQPGLGYSGVRELEDRRSQQMFQFNLQDFRCCA
VLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRILETVNSVRHPFLV
NLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYR
DLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWW
GLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLG
AGEKDAEDVKKHPFFRLIDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPR
EPRILSEEEQEMFRDFDYIADWC
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggcgtccaaccccgaacggggggagattctgctcacagagttgcagggagattcccgg
agtcttccattttctgagaatgtgagtgctgttcaaaaattagacttttcagatacagtg
gtgcaacagaaattggatgacatcaaggatcgaatcaagagagaaataaggaaagaactg
aaaatcaaagaaggagctgaaaatctgaggaaagtcacaacagataaaaaaagtttggct
tatgtggacaacattttgaaaaaatcaaataaaaaactagaagaactgcatcacaagcta
caggaactaaatgcacatattgttgtatcagatccagaagatgttacagattgcccaagg
actccagatacccctagcagtgaccctcgttgttccactagcaataatagattgatggct
ttacaaaaacaattggatatagaacttaaagtaaaacaaggtgcagagaacatgatacag
atgtattcaaatggctcttcaaaggatcggaaactccacggcacagctcagcagctgctc
caggacagcaagacaaaaatagaagtgatacgaatgcagattcttcaggcagtccagacc
aatgaattggcttttgataatgcaaaacctgtcataagtcctcttgaacttcggatggaa
gaattaaggcatcattttaggatagaatttgcagtagcagaaggtgcaaagaatgtaatg
aaattacttggctcaggaaaagtaacagacagaaaagcactttcagaagcccaagcaaga
tttaatgaatcaagtcagaagttggaccttttaaagtattcattagagcaaagattaaat
gaactccccaagaatcaccccaaaagcagtattatcattgaggagctttcacttgttgca
tcaccaacactaagtccacgtcaaagtatgatatctacacagaaccaatatagtacactg
tccaaaccagcagcactaacaggtactttggaagttcgtcttatgggctgtcaagatatt
ctagagaatgtccctggacggtcaaaagcaacatcggttgcactacctggttggagtcca
agtgaaaccagatcatctttcatgagcagaacaagtaaaagtaaaagtggaagtagtcga
aatctcctaaaaaccgacgacttgtccaatgatgtctgtgcggttttgaagctagataat
actgtggttggtcagacgagctggaaacccatttccaatcagtcatgggaccagaagttt
acactggaactggacaggtcacgtgaactggaaatttcagtttattggcgtgattggcga
tctctgtgtgctgtaaaatttctgaggttagaagattttttagacaaccaacggcatggc
atgtgtctctatttggaaccacagggtactttatttgcagaggttaccttttttaatcca
gttattgaaagaagacccaaactccaaagacaaaagaaaattttttcaaaacaacaaggc
aaaacatttctcagagctcctcaaatgaatattaatattgccacttggggaagactagtg
agaagagctattccaacagtaaatcattctggcacctttagccctcaagcctccgtgcct
gctacagtgccagtggttgatgtacgcatccctgaactagcacctccagctggtgattct
acagtaaccaaattggactttgatcttgaacctgaacctcctccggccccaccacgtgac
tcttcccttggagaaatagatgaatctgctgaattaagagattcggatacaccgagacag
gattcagaagctgtttttgctattgagaatgacagaaacagtatacttccaaaatctcaa
tctgaatatgagcctgatattcctcaaccaggcctaggatacagtggtgttcgagaactt
gaggatagaagatctcaacagatgtttcagtttaatctacaagacttcagatgttgtgct
gtcttgggtagaggacattttggaaaggtgcttttggctgaatataaacacacaaacgag
atgtttgctataaaagccttaaagaaaggagatattgtggctcgagatgaagtagacagc
ctgatgtgtgaaaaaagaattttggaaactgtgaatagtgtaagacatccctttttggtg
aacctttttgcatgtttccaaaccaaagagcatgtttgctttgtaatggaatatgctgcc
ggtggggacctaatgatgcacattcatactgatgtcttttctgaaccaagagctgtattt
tatgctgcatgtgtagttcttgggttgcagtatttacatgaacacaaaattgtttataga
gatttgaaattggataacttattgctagatacagagggctttgtgaaaattgctgatttt
ggtctttgcaaagaaggaatgggatatggagatagaacaagcacattttgtggcactcct
gaatttcttgccccagaagtgttaacagaaacatcctatacaagggctgtagactggtgg
ggccttggtgttcttatatatgagatgctcgttggtgagtctccctttcctggtgatgat
gaagaggaagtttttgacagtattgtaaatgatgaagtaaggtatccaaggttcttatct
acagaagccatatcaataatgagaaggctattacgaagaaatcctgagcggcgacttgga
gctggtgagaaagatgcagaggatgtaaaaaagcacccatttttccggctaattgattgg
agtgctctgatggacaaaaaagtaaagccgccatttgtacctaccattagaggacgagaa
gatgttagtaattttgatgatgaatttacctcagaagcacctattttgactccgcctcga
gaaccaaggatactttcagaagaggagcaagaaatgttcagagattttgactacattgct
gactggtgttaa

KEGG   Felis catus (domestic cat): 101097547
Entry
101097547         CDS       T02385                                 
Symbol
PKN1
Name
(RefSeq) serine/threonine-protein kinase N1 isoform X1
  KO
K06071  serine/threonine-protein kinase N1 [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05132  Salmonella infection
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101097547 (PKN1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101097547 (PKN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101097547 (PKN1)
   05135 Yersinia infection
    101097547 (PKN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101097547 (PKN1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101097547 (PKN1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKN family
   101097547 (PKN1)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like PL48 Uds1 C2 Haspin_kinase ABC1
Other DBs
NCBI-GeneID: 101097547
NCBI-ProteinID: XP_023102067
Ensembl: ENSFCAG00000013492
LinkDB
Position
A2:10261230..10284765
AA seq 953 aa
MACQPCRGAGRIWCCRSHKSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRKEIRK
ELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAAAAR
DAPQSPGAGSQACSATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQ
QMLQDSKTKIDIIRMQLRRAGQLESQAAPDDAQGSADLGSVELRIEELRHHFRVEHAVAE
GAKNVLRLLSAAKAPDRKAVCEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLRE
ELAVASSAAFSARLAGPFPPTHYNTLCKPAPLTGTLEVRVVGCRDLPETVPWSSSPSVGV
PGTPDSRTTFLSRPARGLYSRSGSLSGRGSLKVEAENTSEVSTVLKLDNTVVGQTSWKPC
GPNAWDQSFTLELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCL
VAEVTFRNPVIERIPRLRRQKKIFSKQQGKTFQRARQMNIDVATWVRLLRRLIPNATATG
TFSPGASPGPEARSTGDVSMEKLNLGADLDSLPQKSPLGPPSSPSSLSSPIQETTTTPEL
PSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKG
DIVARDEVESLMCEKRILAAVTRAAHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHS
DVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYG
DRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVN
DEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWDTLLARRLPP
PFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTATEQAAFRDFDFVAGGC
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggcctgtcagccttgccgcggagctgggcgtatctggtgttgccgatcacataagagc
gagccgcgcagctggtccctgctggagcagctgggcctggccggtgcggacctggcggcc
ccgggggtgcagcagcagctggagctggagcgggagcggctgcggaaagagatccgcaag
gagctgaagctgaaggagggcgccgagaacctgcggcgggccaccaccgacctgggccgc
agcctgggccccgtggagctgctgctgcgcggctcctcgcgccgcctggacctgctgcac
cagcagctgcaggagctgcacgcccacgtggtgctgcccgaccctgcggccgccgcccga
gatgcccctcagtctcctggtgcaggtagccaggcctgctcggccaccaacctgagccgc
gtggccggcctggagaagcagctggccattgagctgaaggtgaagcagggggcagaaaac
atgatccagacatacagcaacggcagcaccaaggaccggaagctgctgctgacggcccag
cagatgctgcaggacagcaagaccaagatcgacatcatccgaatgcagcttcgccgggcg
ggccagctggagagccaggcagcccccgacgatgcccaagggagtgcagacctggggtcc
gtggagctgcgcattgaggagctgaggcaccacttccgagtggagcacgccgtggccgag
ggtgccaagaacgtgctgcgcctgctcagcgccgccaaggccccggaccgcaaggcggtc
tgcgaggcccaggagaagctgaccgagtccaaccagaagctggggctgctgcgggaggct
ctcgagcggcgcctcggggagttgcccgcggaccatccgaaggggcgactgctgcgcgag
gagcttgctgtggcctcgtcggcagccttcagtgcccgcctggcggggcccttccctccc
acgcactacaacaccctgtgcaagcccgcgccactcacagggaccctggaggtgcgtgtg
gtaggctgcagggaccttccagagaccgtcccctggagctcctcaccctcggtgggggtg
cctggcacccccgacagccgcaccaccttcctgagccgcccagcccggggcctttacagc
cgaagcggaagcctcagtggccggggcagcctcaaagtggaagccgagaacaccagcgag
gttagcactgtgctcaagctggataacacagtggtggggcagacctcctggaagccgtgt
ggccccaacgcctgggaccagagcttcaccctggagctggaaagggcccgggaactggag
ttggctgtgttctggcgggaccaacggggcctgtgtgccctcaaattcctgaagttggag
gatttcttggacaacgagaggcatgaagtgcagctggacatggaaccccagggctgcctg
gtggccgaggttaccttccgcaaccctgtcattgagaggataccccggctccgaaggcag
aagaaaatattctccaagcaacaagggaaaacatttcagcgcgctaggcagatgaacatc
gatgttgccacctgggtgcggctgcttcgaaggctcattcccaatgccacggccacgggt
accttcagccctggggcctctccgggacctgaggcccggtccacaggcgatgtatctatg
gagaagctgaaccttggggctgacttggatagtttgccccagaagagtcctctgggccct
ccttccagcccgtcgagcctgagctccccgatccaggaaactaccaccactcccgagctg
ccttcggagacccaggagaccccaggccccgccctgtgcagccctctgaggaagtcaccc
ctgaccctcgaggatttcaaattcctggcggtgctgggccggggtcactttgggaaggtg
ctgctctctgagttccggcccagcggggagctgttcgccatcaaggctttgaagaaaggc
gacattgtggcccgagatgaggtggagagcctgatgtgcgagaagcggatcttggcggcg
gtgaccagagcagcacatcccttcctggtgaacctgttcggctgtttccagacgccagag
cacgtgtgcttcgtgatggagtactcagccggcggggatctgatgctgcacatccacagt
gacgtgttctctgagccccgcgctgtcttttattcggcctgtgtggtgctggggctgcag
ttcctgcacgaacacaagatcgtctacagggacctgaagttggacaatttgctcctggac
accgagggctatgtcaagatcgcagactttggcctctgcaaggaggggatgggctatggg
gaccggaccagcacattttgtgggaccccggagttcctggcacctgaggtgctgacagac
acatcttacacaagggccgtggactggtgggggctgggtgtgctgctctacgagatgctg
gttggagagtccccgttcccaggggacgacgaggaggaggtatttgacagcatagtcaat
gatgaggttcgctacccacgcttcctgtctgccgaagccattggcatcatgcgcaggctg
ctgcggaggaatccagagcggaggttggggtccagcgagagggacgcagaggatgtgaag
aagcagcccttctttcggacactgggctgggacactctgctggcccggcgcttgccacct
cccttcgtgcccacgctgtcaggccgcacggatgtcagcaacttcgatgaggaattcaca
ggggaggcccccacgctgagcccgccccgcgacgcgcggcccctcacggccactgagcag
gcagccttccgggacttcgacttcgtggccgggggctgctag

DBGET integrated database retrieval system