KEGG   Felis catus (domestic cat): 101081737
Entry
101081737         CDS       T02385                                 
Symbol
KLRB1
Name
(RefSeq) killer cell lectin-like receptor subfamily B member 1
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
fca  Felis catus (domestic cat)
Pathway
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101081737 (KLRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101081737 (KLRB1)
   04091 Lectins [BR:fca04091]
    101081737 (KLRB1)
CD molecules [BR:fca04090]
 Proteins
  101081737 (KLRB1)
Lectins [BR:fca04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   101081737 (KLRB1)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 101081737
NCBI-ProteinID: XP_006933566
Ensembl: ENSFCAG00000024107
UniProt: A0A2I2UTS1
LinkDB
Position
B4:complement(45950652..45964488)
AA seq 225 aa
MDRQVTYADLNLSRGPCLESSSPPSLPQDICQGPPWHQLALKLGCTGVILLTLTVIGLSI
SVIFLRQNLSIEESGVDVHENRNETTEKPDLLKCPKDWRLLREKCLFFSRVSNTWNYSLA
DCSTKESSLLLFQDPEELRHVQSLIPKKEFLFWIGLNLTLSEKKWKWINGSFLNPNVLRI
VGYTKKNSCVYVSPTGIFSEDCDTDNKWICQKEPQPVRKKACSGS
NT seq 678 nt   +upstreamnt  +downstreamnt
atggacagacaagtgacatatgctgatttaaacttatccaggggtccttgcctggaaagt
tcatcacccccatctcttcctcaggacatctgtcaaggtccaccttggcatcagttggct
ctgaaacttggttgtactggggttattcttcttaccttgactgtgattgggttgagtatt
tcagtaatattcttaagacaaaacttgtcaatagaagaaagcggtgtggatgttcacgag
aacaggaatgaaactacagagaagccagatctgttaaagtgcccaaaagattggcgtcta
ctgcgagaaaaatgtttgtttttttctcgcgtttccaacacttggaactacagtctagct
gactgttccacaaaagaatccagtttgctgctttttcaagatccagaagaactgagacac
gtacaaagcctgatacctaaaaaagaatttctgttttggattggattaaatttaacatta
tcagagaagaaatggaagtggataaatgggtcatttttaaatccaaacgtattacgtatt
gttggttatactaagaaaaacagctgtgtttacgtctccccgacaggaattttttctgag
gactgtgacacagacaataaatggatctgccagaaagaaccacaacctgtcagaaagaag
gcgtgttcgggctcttga

KEGG   Felis catus (domestic cat): 101086984
Entry
101086984         CDS       T02385                                 
Name
(RefSeq) NKG2-D type II integral membrane protein
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05144  Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101086984
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    101086984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101086984
   04091 Lectins [BR:fca04091]
    101086984
CD molecules [BR:fca04090]
 Proteins
  101086984
Lectins [BR:fca04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   101086984
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R MSC
Other DBs
NCBI-GeneID: 101086984
NCBI-ProteinID: XP_003988460
UniProt: A0A5F5Y553
LinkDB
Position
B4:complement(46701663..46715266)
AA seq 215 aa
MNLVRDRWACHSMAMDAVRNSNSELVYHGISTRPKRRRVLNTSKYRENPSPFFLVHSIAI
ALGIHFIIMVMICGAIIIHSLFHQEDPLPLQESYCGPCPKNWICYRNTCYQFFNESKSWY
QSQASCVSQNSSLLKIYSREHQDFLKLVKSYHWMGLIQTPPNGSWQWEDGSILLPDQLTM
VDMQNGTCAVYGSNFKAYTENCLTPNTYICMQRIV
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaatctggtccgagatcggtgggcttgtcacagcatggccatggacgcagtccgtaat
tccaactctgagctggtatatcatggtatttccacacgaccaaagagaaggcgtgtatta
aacacaagcaaatatagagaaaacccatctccatttttcctagtccattccattgctata
gctctggggatccacttcattattatggtaatgatatgcggtgccataatcatacattca
ttattccaccaagaagatccacttcctttacaagaaagttattgtggcccatgtcctaaa
aactggatatgttatagaaatacctgctaccaattttttaatgaaagcaaaagctggtac
caaagccaagcctcttgtgtatctcaaaattccagtctcttgaagatatacagcagagaa
caccaggatttcctaaaattggtgaagtcttatcattggatgggactaatacaaactcca
ccaaatggatcatggcaatgggaagatggcagcattctcttacccgaccaactaaccatg
gttgacatgcagaatggaacctgtgcagtttacgggtcaaattttaaagcctatacagaa
aactgtttaactccaaacacatacatctgcatgcagaggattgtgtaa

DBGET integrated database retrieval system