KEGG   Felis catus (domestic cat): 101081745
Entry
101081745         CDS       T02385                                 
Symbol
ITGA4
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04514  Cell adhesion molecules
fca04640  Hematopoietic cell lineage
fca04670  Leukocyte transendothelial migration
fca04672  Intestinal immune network for IgA production
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05165  Human papillomavirus infection
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101081745 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101081745 (ITGA4)
   04514 Cell adhesion molecules
    101081745 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081745 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101081745 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101081745 (ITGA4)
   04670 Leukocyte transendothelial migration
    101081745 (ITGA4)
   04672 Intestinal immune network for IgA production
    101081745 (ITGA4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101081745 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101081745 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101081745 (ITGA4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101081745 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101081745 (ITGA4)
   05414 Dilated cardiomyopathy
    101081745 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081745 (ITGA4)
   04515 Cell adhesion molecules [BR:fca04515]
    101081745 (ITGA4)
   04090 CD molecules [BR:fca04090]
    101081745 (ITGA4)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101081745 (ITGA4)
  Exosomal proteins of other cancer cells
   101081745 (ITGA4)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101081745 (ITGA4)
CD molecules [BR:fca04090]
 Proteins
  101081745 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha DUF11 URO-D
Other DBs
NCBI-GeneID: 101081745
NCBI-ProteinID: XP_003990960
Ensembl: ENSFCAG00000010843
UniProt: M3WE16
LinkDB
Position
C1:171879679..171975377
AA seq 1036 aa
MAGEARCWPGPRGAAVREAVLLPLLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVV
LHSHGANRWLVVGAPTASWLANASVVNPGAIYRCKIGENPDLTCEQLQLGSPTGEPCGKT
CLEERDNQWLGVTLSRQPGENGSIVACGHRWKNIFYIKNENKLPTGVCYGMPPDLRTELS
KRIAPCYQDYVRKFGENFASCQAGISSFYTEDLIVMGAPGSSYWTGSLFVYNITTNKYKA
FLDKDNEVKFGSYLGYSVGAGHFRSPHTTEVVGGAPQHEQIGKAYIFSIEARELNILHEM
KGKKLGSYFGASVCAVDLNADGFSDLLVGAPMQSIIREEGRVFVYINSGSGAVMNEMETE
LLGSDKYAARFGESIVNLGDLDNDGFEDVAIGAPQEDGLRGAIYIYNGRADGVSPTFSQR
IEGLQISQSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLKHPE
SVNRTNFDCVENGLPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKTDSPSRFYFSS
NGTSDVITSSMKVSSKVASCRTHQAFMRKDVRDILTPIQIEAAYHLGHHVISKRSTEEFP
PLQPILQQKKEKDRIEKTINFARFCAHQNCSADLQVSGRIGFFKPHENKTYLAVGSMKTL
MLNVSLFNAGDDAYETTLHIRLPSGLYFVKILDLEEKQINCEVTDSAGLVKLDCSVGYIY
VDHLSRIDISFLLDGSSLSRAEEDLNITVHATCANEGEMDNLKRNKVTLAIPLKYEVMLS
VHGFVNPTSFVYGPKEENEPETCMSEKMNFTFHVINTGHSMAPNVSVEIMVPNSFAPQTD
KLFNLLDVQTTAGDCHFKSYQRKCASEQDKGPLETLKDIFRFLSKTDKKLLFCIKADPYC
LSLLCNFGNMESGKEASVHMQLEGRPSLSEMDETSALTFEIRATAFPEPNPKVIELNKDE
NVAHVFLEGLHHQRPKRHFTIAIISSSLLLGLILLLLISYVMWKVGFFKRQYKSILQEEN
RRDSWSYVNSKSNDDD
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggctggggaagcgaggtgctggccgggtccccgaggggccgccgtccgggaggcggtg
ttgctgccgctgctgctgctgtgcctgggcgtcccgaccgggcgcccctacaacgtggac
accgagagcgcgctgctctaccagggcccccccaacaccctgttcggttattcggtggtg
ctgcacagccacggggcgaaccgatggctcgtagtgggggcgcccaccgccagctggctc
gccaacgcttcagtggtcaatcctggcgcgatttacagatgcaagatcggagagaatcca
gacctgacgtgcgaacagctccagctgggtagccctactggagaaccttgtggaaagact
tgtctggaagaaagagacaatcagtggttgggggtcacactttccagacagccaggagaa
aatggctccatcgtggcttgtgggcatagatggaaaaatatattttatataaagaatgaa
aataagctccctacgggtgtttgctatggaatgccccctgatttacgaacagaactgagc
aaaagaatagctccgtgttatcaagattatgtgagaaaatttggagaaaattttgcatca
tgtcaagctggaatatctagtttttacactgaggatttaattgtgatgggagccccagga
tcatcttattggactggctctctttttgtctacaatataactacaaataagtacaaggct
tttttagacaaagataatgaagtaaaatttggaagttatttaggctactccgttggagct
ggtcattttcggagtccgcatactaccgaagtagttggaggagcccctcaacatgaacag
attggtaaagcatacatattcagcatcgaggccagagaactaaacatcttacatgaaatg
aaaggtaaaaagcttggctcctattttggagcttctgtctgtgccgtggacctcaacgca
gacggcttctcagacctcctcgtgggagctcccatgcagagcatcatcagggaggaaggc
agagtgtttgtgtatatcaactctggctcaggagcagtaatgaacgaaatggaaacagag
ctccttggaagtgacaaatatgctgcaagatttggggaatctattgttaatcttggagac
cttgataatgatggctttgaagatgttgcaattggagctccacaggaagatggcttgaga
ggtgctatttatatttacaacggccgagcagatggggtctcaccaacgttctcacagaga
attgaaggacttcaaatcagccaatcattaagtatgtttggacagtctatatctggacaa
attgatgcagataataatggatatgtagatgtggcagttggtgcttttcggtctgattct
gctgtgctgctgaggacaagacccgtagtgattgttgaagcttctttaaaacatcctgag
tcagtaaatagaacaaattttgactgtgttgaaaatggattgccttctgtgtgcatggat
ctaacactctgtttctcatacaagggcaaagaggttccaggttatattgttttgttctat
aacatgagtctggatgtgaaccggaagacagactctccatcaagattttacttttcttct
aatggaacatctgatgtgattacaagcagcatgaaagtgtcaagcaaagtagctagctgc
agaacacatcaagcatttatgcggaaagatgtgcgggacatcctcaccccaattcagatt
gaagctgcttaccaccttgggcatcacgtcatcagtaaacgaagtacagaggaattcccc
ccacttcaaccaattcttcagcaaaagaaagaaaaagacagaattgaaaaaacgataaat
tttgcaagattttgtgcccaccaaaattgctctgctgacttacaggtttctgggagaatt
ggattttttaagccacatgaaaataagacctatcttgctgttggaagtatgaagaccttg
atgttgaacgtgtccttgtttaatgctggagatgatgcgtacgaaacgactctgcacatc
agactcccctccggtctttacttcgttaagattttagatctggaagagaaacaaataaac
tgtgaagtaacagacagtgctggcttagtaaagctcgactgcagtgttggatatatatat
gtagatcacctatcaaggatagatattagctttctcttggatgggagctcactcagcaga
gcagaagaggatctcaacatcacagtgcacgccacctgtgcaaatgaaggagaaatggac
aatctgaagcgtaacaaagtgactttagcaatacctctcaagtatgaagtcatgctatct
gttcatgggtttgtaaacccaacttcatttgtgtatggaccaaaggaagaaaatgagcct
gaaacatgcatgtcagagaaaatgaacttcacttttcatgttatcaacactggccatagc
atggctccaaatgttagtgtggaaataatggtaccaaattcttttgccccccaaactgat
aaactgttcaaccttttggatgtccagactactgctggagattgccattttaaaagttat
caaagaaagtgtgcatcagagcaggataaaggtccactggagaccctgaaagacattttc
agattcttgtcaaagactgataagaagctattgttctgcataaaagctgatccatactgt
ttaagtcttttatgtaattttgggaatatggaaagtggaaaagaagccagtgttcacatg
cagttggaaggccgcccatctctttcagaaatggatgagacttcagcgctcacatttgag
ataagagcaacggcttttccagagcctaatccaaaagttattgaactaaacaaggatgaa
aatgttgcacatgttttccttgaaggactacatcatcaaagacccaaacgtcatttcaca
atagcaattatttcaagtagcttgctacttggccttattttacttttattgatttcgtat
gttatgtggaaggttggtttctttaaaagacagtacaaatctatcctacaagaagaaaac
agaagagacagttggagttacgttaacagcaaaagcaatgatgatgattga

KEGG   Felis catus (domestic cat): 101093870
Entry
101093870         CDS       T02385                                 
Symbol
ITGA5
Name
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04640  Hematopoietic cell lineage
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05133  Pertussis
fca05135  Yersinia infection
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101093870 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101093870 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101093870 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101093870 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101093870 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101093870 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101093870 (ITGA5)
   05205 Proteoglycans in cancer
    101093870 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101093870 (ITGA5)
   05165 Human papillomavirus infection
    101093870 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101093870 (ITGA5)
   05133 Pertussis
    101093870 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    101093870 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101093870 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101093870 (ITGA5)
   05414 Dilated cardiomyopathy
    101093870 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101093870 (ITGA5)
   04515 Cell adhesion molecules [BR:fca04515]
    101093870 (ITGA5)
   04090 CD molecules [BR:fca04090]
    101093870 (ITGA5)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101093870 (ITGA5)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101093870 (ITGA5)
CD molecules [BR:fca04090]
 Proteins
  101093870 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101093870
NCBI-ProteinID: XP_003988849
Ensembl: ENSFCAG00000010155
UniProt: M3WCS8
LinkDB
Position
B4:complement(82693110..82715897)
AA seq 1104 aa
MPPLSPPRPAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGRRAPGFPLH
AVQLRWGPRRRPPLLLLLPPLLLLLLPPPPRVGGFNLDAEAPAVLAGPPGSFFGFSVEFY
RPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGTSPVHCTPIEFDSKGSRLLESLLPS
PEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLNDPVGTCYLSTDNFTRIL
EYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYP
EYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILN
GSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMERTADGRPQEVGRVYI
YLQNLAGMEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGDTQRGVVFI
FPGGPAGLGSKPSQVLLPLWAAGHTPNFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVY
RGRPIVSTSASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVPDSIGFTVELQ
LDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIA
LNFSLDPQAPVDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVY
LGDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRNPGNFSSLSCDYFAVNQSR
LLVCDLGNPMKAGASIWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSEVVSFRLSVE
AQAQVSLNGVSKPEAVLFPVSDWHPRDQPQEEGDVGPAVHHVYELINLGPSSISRGVLEL
SCPQALEGQQLLYMTRVTGLGNCTTSHPPNSQGLELDPEGSQHHLLQRREAPGRSPASPG
PQILKCPEAECFRLRCELGPLHRQESRSLQLHFRVWAKTFLQREHQPFSLQCEAVYEALK
MPYRILPQQLPRKELQVATAVQWTKAEGSHGVPLWIIILAILIGLLLLGLLIYILYKLGF
FKRSLPYGTAMEKAQLKPPATSDA
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgccccccctctcgcccccccggccggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagacgggcaccagggttccctctccac
gccgtgcaactgcgctggggcccccggcgccgacccccgctgctgctgctgctgccgccg
ctgctgctgctgctgctgccgccgccacccagggtcgggggcttcaatttagacgcggag
gccccagctgtgctcgctgggcccccgggctccttcttcggcttctcggtggagttttac
cggccggggacggacggggtcagcgtgctggtgggagctcccaaggccaacaccagccag
ccgggagtgctgcagggtggtgccgtctacctctgtccctggggcaccagcccggtacac
tgcacccccattgaatttgacagtaaaggctctcgactcctggagtcattactgcccagc
ccagagggagaggagcctgtggagtacaagtccttgcagtggtttggagcgacggttcga
gcccacggctcctccattttggcctgtgctcctctatatagctggcgcacagagaaggag
ccgctgaatgatcccgtgggcacctgctacctctccacggacaatttcacccgaattctg
gagtatgcaccttgccgctcagatttcagctgggccgcaggacagggttactgccaaggg
ggcttcagtgctgagttcaccaagaccgggcgcgtggtcctgggtggaccaggaagctac
ttctggcaaggccagatcctgtcggccacccaagaacagattgctgaatcctattacccc
gagtacctgatcaacctggttcaggggcagctgcagacccgccaggccagttccatctac
gatgacagctacctgggatactctgtggctgtgggtgaattcagtggtgatgacacagaa
gactttgtcgctggcgtgcccaaagggaacctcacttatggttatgtcaccatcctcaat
ggctcagacatccgatctctctacaacttctcaggggaacagatggcgtcctacttcggc
tatgcagtggctgccacagacgtcaacggggacgggctggacgacttgctggtgggggca
cctctgctcatggaacggacagctgatgggcggcctcaggaagtgggcagggtctacatc
tacctgcagaacctggctggcatggagcccacccccaccctcaccctcactggccatgat
gagtttggccgatttggcagctccttgacgcccctgggggacctggaccaggatggctac
aatgatgtagcgattggagctccctttggcggagacacccagcggggagtggtgtttata
ttccctgggggcccagcggggctaggctctaagccttcccaggttctgctgcccctgtgg
gcagccggccacacgccaaacttctttggctctgcccttcgaggaggccgagacctggat
ggcaacggataccctgatctgatcgtggggtcctttggtgtggacaaggctgtggtgtac
aggggtcgccccatcgtctctaccagtgcctccctcaccatcttccctgccatgttcaac
ccagaggagcgtagctgcagcttggaggggaaccctgtggcttgcatcaaccttagcttc
tgcctcaatgcttctggaaaacatgttcctgactccattggcttcacagtagaactccag
ttggactggcagaagcagaaggggggagtacggcgggcactgttcctggcctccagacag
gcgaccctgacccagaccctactcatccagaacggggcacgggaggactgcagagagatg
aagatctacctcaggaacgagtcagaattccgagacaagctctccccgattcatatcgcc
cttaacttctccctggacccccaagcccctgtggacagccatggcctccggccagtctta
cattaccagagcaagagccgcatcgaggacaaggctcagatcttgctggactgtggagaa
gacaatatctgtgtgccagacctacagctggaagtgtttggggagcagaaccacgtgtac
ctgggtgacaagaactccctgaacctaactttccacgcccagaacgtgggtgagggcggc
gcctatgaggccgagcttcgggtcacagcccctccagaggctgagtactcaggactcgtc
agaaacccagggaacttctccagcctgagctgtgactactttgccgtgaaccagagccgc
ctgctggtgtgtgacctgggaaaccccatgaaggcaggagccagtatctggggggggctg
cggttcacagtccctcatctccgggacacaaagaaaaccatccagtttgacttccagatt
ctcagcaagaatctcaacaactcccaaagcgaagtggtttccttcaggctctcagtggag
gctcaggcccaggtctcccttaacggtgtctccaaacccgaggcagtgctattcccagtg
agcgactggcatccccgagaccagcctcaggaggagggagatgtgggtcctgctgtccac
cacgtctatgagctgatcaacttgggccccagctccattagccggggtgtgctggaactc
agctgtccccaggctctggaaggtcagcaacttctctacatgaccagggttacaggactt
ggtaactgcaccaccagtcacccccccaactcacagggcctggagttggatcctgagggt
tcccagcaccacctgctacagagacgggaagctccaggccggagccctgcctccccagga
cctcagatcctgaaatgccccgaagcagaatgttttaggctgcgttgtgagctcgggcca
ctgcaccggcaagagagccgaagtctgcaactgcattttcgagtgtgggccaagaccttc
ctgcaacgggagcaccagcccttcagcctgcagtgtgaagccgtgtatgaagccctgaag
atgccttaccgaatcctgcctcagcagcttccccgaaaggaacttcaggtggccacggct
gtgcagtggaccaaggcagaaggcagccacggtgtcccactgtggatcattatcctagcc
atcctcattggcctcctgctcctaggtctgctcatctacatcctctacaagctcggattc
ttcaaacgctccctcccatacggcaccgccatggaaaaagctcaactcaagccaccagcc
acctctgatgcctga

DBGET integrated database retrieval system