KEGG   Felis catus (domestic cat): 101081808
Entry
101081808         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 5A, mitochondrial
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081808
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101081808
  09159 Environmental adaptation
   04714 Thermogenesis
    101081808
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101081808
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081808
   05012 Parkinson disease
    101081808
   05014 Amyotrophic lateral sclerosis
    101081808
   05016 Huntington disease
    101081808
   05020 Prion disease
    101081808
   05022 Pathways of neurodegeneration - multiple diseases
    101081808
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101081808
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101081808
SSDB
Motif
Pfam: COX5A
Other DBs
NCBI-GeneID: 101081808
NCBI-ProteinID: XP_003986990
Ensembl: ENSFCAG00000010587
UniProt: A0A5F5XZ66
LinkDB
Position
B3:33370219..33385684
AA seq 152 aa
MLGAALRRCAVAAAAAPRASPRGLLYPAPGPGSAAAVQSVRCYSHGSHETDEEFDARWVT
YFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGP
HKEIYPYVIQELRPTLNELGISTPEELGLDKV
NT seq 459 nt   +upstreamnt  +downstreamnt
atgctcggcgccgctctccgccgttgcgctgtagcagcagccgcagccccccgtgccagc
ccccgaggcctcctgtacccagctccgggtcccggctccgccgccgctgtccagtcagtt
cgctgctactcccatgggtcacatgaaacagatgaggagtttgatgctcgctgggtgaca
tacttcaacaagccagatattgacgcctgggaattgcgtaaaggaatgaacacgcttgtt
ggctatgatctggttccagaacctaaaatcattgatgctgctttgcgggcatgcagacgg
ttaaatgattttgctagtgcagttcgcatcctagaggttgttaaggacaaagcaggacct
cataaggaaatctacccctatgtcatccaggaacttagaccaactttaaatgaactggga
atctccactccagaggaactgggccttgacaaagtgtaa

KEGG   Felis catus (domestic cat): 101083819
Entry
101083819         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 7A1, mitochondrial isoform X2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101083819
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101083819
  09159 Environmental adaptation
   04714 Thermogenesis
    101083819
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101083819
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101083819
   05012 Parkinson disease
    101083819
   05014 Amyotrophic lateral sclerosis
    101083819
   05016 Huntington disease
    101083819
   05020 Prion disease
    101083819
   05022 Pathways of neurodegeneration - multiple diseases
    101083819
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101083819
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101083819
SSDB
Motif
Pfam: COX7a COX14
Other DBs
NCBI-GeneID: 101083819
NCBI-ProteinID: XP_003997968
Ensembl: ENSFCAG00000014155
UniProt: M3WK61
LinkDB
Position
E2:17529543..17531306
AA seq 80 aa
MRALRVSQALVRSFSSTARNRFENRVAEKQKVFQADNDLPVHLKGGATDNILYRLTMGLC
LGGTVYSLYCLGWASFPHNK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagggccctgcgggtctcccaagcactggttcgctctttcagctcaaccgcccggaac
cgctttgagaaccgagtggctgagaaacagaaagtcttccaggcggacaatgacctccca
gtacacttgaagggcggggcaacagacaacatcctgtatcgactgaccatgggcctgtgt
ctagggggcaccgtctatagcctgtactgccttggctgggcctccttccctcacaacaag
tga

KEGG   Felis catus (domestic cat): 101085531
Entry
101085531         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 7B, mitochondrial
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085531
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101085531
  09159 Environmental adaptation
   04714 Thermogenesis
    101085531
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101085531
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085531
   05012 Parkinson disease
    101085531
   05014 Amyotrophic lateral sclerosis
    101085531
   05016 Huntington disease
    101085531
   05020 Prion disease
    101085531
   05022 Pathways of neurodegeneration - multiple diseases
    101085531
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101085531
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101085531
SSDB
Motif
Pfam: COX7B
Other DBs
NCBI-GeneID: 101085531
NCBI-ProteinID: XP_004000711
Ensembl: ENSFCAG00000023091
UniProt: A0A2I2UIV7
LinkDB
Position
X:65582595..65588021
AA seq 80 aa
MFPMARNAFSRLRVQSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCVAVWAYTATQI
GIEWNLSPVGRVTPKEWRDQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgtttcctatggccagaaacgctttcagtcgtctccgagttcaaagcattcagcaaaca
atggcaaggcagagccaccagaaacggacacctgatttccatgacaaatacggtaatgct
gtattagctagtggagccactttctgtgttgctgtatgggcttatacagcaacacaaatt
ggaatagaatggaacctgtcccctgttggcagagtcaccccaaaggaatggagagatcag
tag

KEGG   Felis catus (domestic cat): 101089914
Entry
101089914         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  KO
K02263  cytochrome c oxidase subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089914
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101089914
  09159 Environmental adaptation
   04714 Thermogenesis
    101089914
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101089914
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101089914
   05012 Parkinson disease
    101089914
   05014 Amyotrophic lateral sclerosis
    101089914
   05016 Huntington disease
    101089914
   05020 Prion disease
    101089914
   05022 Pathways of neurodegeneration - multiple diseases
    101089914
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101089914
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101089914
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 101089914
NCBI-ProteinID: XP_023101380
Ensembl: ENSFCAG00000007612
LinkDB
Position
E2:60687188..60694693
AA seq 169 aa
MLATRVFSLIGKRAISTSVCVRAHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQK
ALKEKEKAPWSSLSIDEKVELYRMKFNESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIW
EKHYVYGPIPHTFEEEWVAKQTKRMLDMKVSPIQGFSAKWDYDKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggctaccagagtgtttagcctaattggcaagcgagcaatttccacctcagtgtgt
gtacgagcgcatggaagcgtcgtgaagagtgaagattacgctctcccgagttatgtggac
cggcgtgactaccccctgcccgacgtggcccacgtcaagaacctctctgccagccagaag
gccttgaaagagaaagagaaggccccctggagcagcctctccatcgatgaaaaagttgaa
ttgtaccgcatgaagttcaacgagagcttcgcggaaatgaacaggagcacgaacgagtgg
aagacggttgtgggcgctgccatgttcttcatcggcttcaccgctctcctcctgatctgg
gagaagcactatgtgtatggccccatcccgcacaccttcgaggaggagtgggtggctaag
cagaccaagaggatgctggacatgaaggtcagcccgatccagggcttctcagccaagtgg
gactacgacaagaacgagtggaagaagtag

KEGG   Felis catus (domestic cat): 101090761
Entry
101090761         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 5B, mitochondrial
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101090761
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101090761
  09159 Environmental adaptation
   04714 Thermogenesis
    101090761
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101090761
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090761
   05012 Parkinson disease
    101090761
   05014 Amyotrophic lateral sclerosis
    101090761
   05016 Huntington disease
    101090761
   05020 Prion disease
    101090761
   05022 Pathways of neurodegeneration - multiple diseases
    101090761
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101090761
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101090761
SSDB
Motif
Pfam: COX5B DUF35_N zinc_ribbon_5 zf-RING_4
Other DBs
NCBI-GeneID: 101090761
NCBI-ProteinID: XP_003983971
Ensembl: ENSFCAG00000001704
UniProt: M3VX46
LinkDB
Position
A3:complement(64742446..64744259)
AA seq 129 aa
MASRLLRGVGSLAAQALRVRGPNGVAAVRSMASGGGVPTDDEQATGLEREVMMAARKGLD
PYNMLAPKAASGTKEDPNLVPSITNKRIVGCICEEDNSAVIWFWLHKGEAQRCPSCGTHY
KLVPHQLAH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcttcaaggttacttcgtggagttggatcgctggccgcacaggccctcagggtccgc
ggtcccaatggagtcgccgcagtgcgctccatggcatctggaggcggtgttcctactgat
gatgagcaggcaactgggctggagagggaggtcatgatggctgctcggaagggactggac
ccatacaatatgctagccccaaaagcagcttcaggcaccaaggaagaccctaatttagtg
ccatctatcactaacaagcgaattgtgggctgcatctgtgaagaggacaatagtgctgtc
atctggttctggcttcacaaaggcgaggcccagcgatgccctagctgtggaacccattac
aagctggtgccccatcagttggcccactga

KEGG   Felis catus (domestic cat): 101092350
Entry
101092350         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 7A-related protein, mitochondrial
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101092350
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101092350
  09159 Environmental adaptation
   04714 Thermogenesis
    101092350
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101092350
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092350
   05012 Parkinson disease
    101092350
   05014 Amyotrophic lateral sclerosis
    101092350
   05016 Huntington disease
    101092350
   05020 Prion disease
    101092350
   05022 Pathways of neurodegeneration - multiple diseases
    101092350
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101092350
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101092350
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 101092350
NCBI-ProteinID: XP_003984341
Ensembl: ENSFCAG00000022642
UniProt: A0A2I2UF99
LinkDB
Position
A3:108203949..108225607
AA seq 114 aa
MYYKFSGFTQKLTGTWASDAYSPQGLRPVVSTEAPPIIFATPTKLSSDFTAYDYAGKNKV
PELQKLFQKSDGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtattacaagtttagtggcttcacgcagaagttgactggaacatgggcttccgacgct
tacagccctcagggattaaggcctgtggtttccacagaagcaccgcctatcatatttgcc
acacccaccaaactgagttctgattttactgcatatgattatgctgggaaaaacaaagtt
cctgagctgcagaagcttttccagaagtccgacggtgtgcccatccatctaaaacgaggc
ctgcctgaccaaatgttgtaccggaccaccatggcgctgacagtgggagggaccatctac
tgcctgattgctctctacatggcttcccagcccaaaaacaaatga

KEGG   Felis catus (domestic cat): 101095773
Entry
101095773         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 6A1, mitochondrial
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101095773
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101095773
  09159 Environmental adaptation
   04714 Thermogenesis
    101095773
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101095773
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095773
   05012 Parkinson disease
    101095773
   05014 Amyotrophic lateral sclerosis
    101095773
   05016 Huntington disease
    101095773
   05020 Prion disease
    101095773
   05022 Pathways of neurodegeneration - multiple diseases
    101095773
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101095773
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101095773
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 101095773
NCBI-ProteinID: XP_003994770
Ensembl: ENSFCAG00000031188
UniProt: M3WRN1
LinkDB
Position
D3:16782477..16784324
AA seq 109 aa
MAVAAASRFSGLLGRSGAQRGRSMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLK
SHHGEHERPEFVAYPHLRIRSKPFPWGDGNHTLFHNSHVNPLPTGYEDE
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcggtggcggctgcgtcccggttttcggggctgctaggtcggtccggggcgcagcgg
gggcggtccatgtcgagtggcgcccacggcgaggagggctcagctcgcatgtggaaggcc
ctcacctacttcgtagctcttcctggcgtgggagtgagcatgctgaacgtcttcctgaag
tcgcatcacggagagcacgagagacccgagttcgtcgcctacccccatctccgcatcagg
tccaagccctttccctggggagatggtaatcatactctattccataactctcacgtgaat
ccacttccgaccggctatgaagatgaataa

KEGG   Felis catus (domestic cat): 101096603
Entry
101096603         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 8A, mitochondrial
  KO
K02273  cytochrome c oxidase subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096603
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096603
  09159 Environmental adaptation
   04714 Thermogenesis
    101096603
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101096603
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096603
   05012 Parkinson disease
    101096603
   05014 Amyotrophic lateral sclerosis
    101096603
   05016 Huntington disease
    101096603
   05020 Prion disease
    101096603
   05022 Pathways of neurodegeneration - multiple diseases
    101096603
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101096603
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101096603
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 101096603
NCBI-ProteinID: XP_003993597
Ensembl: ENSFCAG00000014662
UniProt: M3WL37
LinkDB
Position
D1:109340466..109342304
AA seq 69 aa
MSVLTPLLLRGLTGLTRRLPVQRAQIHSKPPQEQLGTMEVAIGLTSCFVCFLLPSGWVLS
HLESYKKRE
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtctgtactgaccccgctgctgctgaggggcctgacaggcctaacccggcggcttccg
gtgcagcgtgctcagatccattccaagcctccgcaggagcagctcgggaccatggaagtc
gccatcgggctcacctcctgcttcgtgtgtttcctcctgccgtcgggctgggtcctgtca
catctggagagctacaagaagcgggagtga

KEGG   Felis catus (domestic cat): 101096643
Entry
101096643         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 4 isoform 2, mitochondrial isoform X2
  KO
K02263  cytochrome c oxidase subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096643
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096643
  09159 Environmental adaptation
   04714 Thermogenesis
    101096643
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101096643
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096643
   05012 Parkinson disease
    101096643
   05014 Amyotrophic lateral sclerosis
    101096643
   05016 Huntington disease
    101096643
   05020 Prion disease
    101096643
   05022 Pathways of neurodegeneration - multiple diseases
    101096643
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101096643
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101096643
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 101096643
NCBI-ProteinID: XP_003983688
Ensembl: ENSFCAG00000014664
LinkDB
Position
A3:complement(27332427..27337940)
AA seq 171 aa
MFFRAVWSLVLRKGGPRMRQMHSPGSAAHSKEKMPPYTNYHAQRSYPMPDEPFCTELNAE
QRALKEKEKGSWTQLTHDEKVALYRLQFHETFAEMNRRSNEWKTVMGCVFFFFGFTALMI
WWQRIYVFPKKPVTLTDEWKAQQLQRILDMKGNPVQGLASRWDYEKKEWKK
NT seq 516 nt   +upstreamnt  +downstreamnt
atgttcttcagagctgtctggagcttggtgctgaggaaaggaggacccaggatgcggcag
atgcacagcccgggaagcgctgcccacagcaaggagaagatgcccccctacactaactac
catgcccagcgctcctaccccatgcccgatgagcccttctgcacagagctcaacgctgag
cagcgggccctgaaggagaaagagaagggcagctggacccagctgacccacgacgagaag
gtggccttgtaccggctccagttccatgagaccttcgcggagatgaaccgtcgctccaat
gagtggaagacagtgatgggctgcgtcttcttcttttttggattcacagctctgatgatt
tggtggcagcggatctatgtgttccctaagaagcctgtcaccctgacggatgagtggaag
gcccagcagctccagcgcatcctagacatgaagggcaaccccgtgcaagggctggcctcc
cggtgggactatgagaagaaggagtggaagaagtga

KEGG   Felis catus (domestic cat): 101096876
Entry
101096876         CDS       T02385                                 
Name
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05415  Diabetic cardiomyopathy
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096876
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096876
  09159 Environmental adaptation
   04714 Thermogenesis
    101096876
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101096876
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096876
   05012 Parkinson disease
    101096876
   05014 Amyotrophic lateral sclerosis
    101096876
   05016 Huntington disease
    101096876
   05020 Prion disease
    101096876
   05022 Pathways of neurodegeneration - multiple diseases
    101096876
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101096876
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101096876
SSDB
Motif
Pfam: COX6C
Other DBs
NCBI-GeneID: 101096876
NCBI-ProteinID: XP_023104305
LinkDB
Position
F2:complement(48090751..48109806)
AA seq 75 aa
MTSGALAKPQMRGLLAKRLRFHIVGAFAVSLGVAAFYKFAVAEPRKKAYADFYRNYDSMK
DFEEMKKAGIFQSAK
NT seq 228 nt   +upstreamnt  +downstreamnt
atgacttccggtgctttggcgaaacctcagatgcgaggccttctggccaagcgcctgcga
tttcatattgtcggagcgttcgctgtttccctgggggttgcagctttctataagtttgct
gtggccgaaccaagaaagaaggcgtatgcagatttctacagaaattatgattccatgaaa
gattttgaggagatgaagaaggctggtatctttcagagtgcaaagtga

DBGET integrated database retrieval system