KEGG   Felis catus (domestic cat): 101081813
Entry
101081813         CDS       T02385                                 
Symbol
SNW1
Name
(RefSeq) SNW domain-containing protein 1
  KO
K06063  SNW domain-containing protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03040  Spliceosome
fca04330  Notch signaling pathway
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101081813 (SNW1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101081813 (SNW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101081813 (SNW1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101081813 (SNW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fca03041]
    101081813 (SNW1)
Spliceosome [BR:fca03041]
 Complex B
  Other components
   Prp19-related factors
    101081813 (SNW1)
 Complex C
    101081813 (SNW1)
SSDB
Motif
Pfam: SKIP_SNW
Other DBs
NCBI-GeneID: 101081813
NCBI-ProteinID: XP_003987921
Ensembl: ENSFCAG00000001637
LinkDB
Position
B3:complement(124731363..124764350)
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDAEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQNIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagcttgaggct
gaagaaaaggcaagatctcagagatcacgacagacctcactggtctcctcccgaagagaa
cctcctccatacgggtaccggaaaggctggatacctcggttattagaggattttggagat
ggcggtgcttttccagagatccatgtggcccagtatccactggatatgggacgaaagaaa
aaaatgtcaaatgcgctggccattcaggtggatgctgaaggaaaaattaaatatgatgca
attgctcggcagggacagtcaaaagacaaggtcatttatagcaagtacactgacctggtt
cccaaggaagtcatgaatgcagatgacccagacctgcaaagacctgatgaggaagccatt
aaagagataacagaaaagacaagggtagccttagaaaaatctgtatcacagaaggttgct
gcagccatgccagtccgagcagctgataaactggctcctgctcagtatatccgatacaca
ccatctcaacaaggagtggctttcaactctggagctaaacagagagttattcggatggtg
gaaatgcaaaaagatccaatggagcctccacggttcaagattaataagaaaattccccga
ggaccaccttctcctcctgcacctgtcatgcattcccctagccggaagatgactgtgaag
gaacaacaagagtggaagattcctccttgtatttcaaactggaaaaatgcaaagggttat
acaattccattagacaagcgtctggctgctgatggaagaggcctgcagacagttcacatc
aatgagaactttgccaagctggctgaagccctctatattgctgatcggaaggctcgtgaa
gctgtagaaatgcgtgcgcaagtagagagaaagatggctcagaaagaaaaggagaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaacc
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgataggcga
aaagaaagacagcacgaccggaatctttccagggcagctcctgataagaggtcaaaactg
cagagaaatgaaaatcgagatatcagcgaagtcattgctcttggtgtacccaatcctcgg
acgtccaatgaagttcagtatgaccaaaggctcttcaaccagtccaagggtatggacagt
ggttttgcaggtggagaagatgaaatttacaatgtttatgatcaagcctggagaggtggt
aaagatatggcccagaatatttacaggcccagtaaaaacctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgataaggagttttctggt
tcagaccgtaggcagagaggccgagaaggaccagttcagtttgaggaagatccttttggt
ttagacaagtttttggaagaagccaaacagcacggtggctctaaaagaccctcagacagc
agccgccccaaggaacatgagcatgaaggcaagaagaggaggaaggagtag

DBGET integrated database retrieval system