KEGG   Felis catus (domestic cat): 101081815
Entry
101081815         CDS       T02385                                 
Symbol
ATP6V1E1
Name
(RefSeq) V-type proton ATPase subunit E 1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081815 (ATP6V1E1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101081815 (ATP6V1E1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101081815 (ATP6V1E1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101081815 (ATP6V1E1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101081815 (ATP6V1E1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101081815 (ATP6V1E1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101081815 (ATP6V1E1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW
Other DBs
NCBI-GeneID: 101081815
NCBI-ProteinID: XP_003988295
Ensembl: ENSFCAG00000008081
UniProt: M3W8X9
LinkDB
Position
B4:34781176..34812966
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctctcagcgatgctgacgtgcaaaagcagattaagcatatgatggcttttattgaa
caggaagccaatgagaaagcagaagaaatagatgcaaaggcagaggaagagttcaacatt
gagaaaggtcgtcttgtgcaaacccaaagactgaagattatggaatactatgagaagaaa
gaaaagcagattgagcagcagaagaaaattcagatgtctaatttgatgaatcaagcaagg
ctcaaagtcctcagagcgagagatgaccttattacagacctactaaatgaagcaaaacaa
agactcagcaaagtggtaaaagatacaaccaggtaccaggtgctgctggatggtctggtg
ctccagggtttgtaccaattgttggagccgcgaatgattgttcgttgcaggaaacaggat
ttccctctggtaaaggctgcagtgcaaaaagcgattcctatgtacaaaattgccaccaaa
aaagatgttgatgtccaaattgatcaggaggcctatctgcctgaggaaatagctggtgga
gttgagatctataatggagatcgtaaaataaaagtttccaataccctagaaagccggctg
gatctcatagcccagcagatgatgccagaagttcggggagccttatttggtgcaaatgcc
aacaggaagtttctggactaa

KEGG   Felis catus (domestic cat): 101081968
Entry
101081968         CDS       T02385                                 
Symbol
ATP6V1F
Name
(RefSeq) V-type proton ATPase subunit F
  KO
K02151  V-type H+-transporting ATPase subunit F
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081968 (ATP6V1F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101081968 (ATP6V1F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101081968 (ATP6V1F)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101081968 (ATP6V1F)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101081968 (ATP6V1F)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101081968 (ATP6V1F)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101081968 (ATP6V1F)
SSDB
Motif
Pfam: ATP-synt_F
Other DBs
NCBI-GeneID: 101081968
NCBI-ProteinID: XP_003983074
Ensembl: ENSFCAG00000000364
UniProt: A0A337SJT0
LinkDB
Position
A2:146916947..146920133
AA seq 119 aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgggtagggggaagctaattgcggtgatcggagacgaggacacagttactggcttc
ctcctgggcggcataggggagcttaacaagaaccgccaccctaatttcctggtggtggag
aaggatacaaccatcaatgagatcgaagacactttccggcagtttctaaaccgggatgac
atcggcattatcctcatcaaccagtacatcgcagagatggtgcggcacgcgctcgacgcc
caccagcgctccatcccagccgtcctggagatcccgtccaaggagcacccctatgatgcc
gccaaggactccatcctgcgccgggcccggggcatgttcacagccgaagacctgcgctag

KEGG   Felis catus (domestic cat): 101083709
Entry
101083709         CDS       T02385                                 
Symbol
TCIRG1
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04142  Lysosome
fca04145  Phagosome
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05152  Tuberculosis
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101083709 (TCIRG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101083709 (TCIRG1)
   04142 Lysosome
    101083709 (TCIRG1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101083709 (TCIRG1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101083709 (TCIRG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101083709 (TCIRG1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101083709 (TCIRG1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101083709 (TCIRG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083709 (TCIRG1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101083709 (TCIRG1)
SSDB
Motif
Pfam: V_ATPase_I FKS1_dom1 TolA_bind_tri
Other DBs
NCBI-GeneID: 101083709
NCBI-ProteinID: XP_023095909
Ensembl: ENSFCAG00000002995
LinkDB
Position
D1:112557096..112568470
AA seq 831 aa
MGSMFRSEEVVLVQLFLPTSAAYTCVSQLGELGLVEFRDLNASVSAFQRRFVGDVRRCEE
LEKTFLFLQEEVRRAGQVLSRPEGRLPAPPPRDLLRIQEETDRLAQELRDVRGNQQSLQV
QLHQLRLHAAVLGQGHSPPLAAAHADGPSERIPLLQPPGGPHQDLRVNFVAGAVEPSKAA
ALERLLWRACRGFLIASFRETEQQLEDPVTGEPSTWMTFLISYWGEQIGQKIRKITDCFH
CHIFPYAEHEEGRLAALQQVQQQSHELQEVLGETERFLSQVLARVQQLLPPWQVQIRKMK
AVYLALNQCSVSATHKCLIAEGWCAARDLPTLQQALQDSSSEAGVSAVVHRIPCRDMPPT
LIRTNCFTASFQGIVDAYGVGRYQEVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALAM
VLTENQPAVKSAQNEIWQTFFSGRYLLLLMGLFSVYTGFIYNECFSRATAIFSSGWSVAA
MATQSDWSDAFLAQHPLLALDPNVSGVFLGPYPFGIDPIWSLAVNHLSFLNSFKMKMSVI
LGVTHMTFGVVLGVFNHVHFGQWHRLLLETLPELVFLLGLFGYLVFLIVYKWLQDYAARA
ASAPSILIHFINMFLFSHSPTNQPLFHGQEAVQSALVILALVMVPVLLLGTPLFLHWRHR
SRSQRGPAGRQPDEDKSGILDSSDASVAGWGPDEEKAGCPEDGEEAEFVLSEVLMHQAIH
TIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRSGLGLGRKLGVAAVALVPIFAA
FAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFTFASEEG
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgggctccatgttccggagcgaggaggtcgtgctggtgcaactcttcctgcccacctcc
gctgcctatacctgcgtgagccagcttggcgagctgggtctcgtggagttcagagacctc
aatgcctcggtgagcgccttccagagacgcttcgtgggggatgtgcgacgctgcgaagag
ttggagaaaaccttcttgttcctgcaggaggaggtgcggcgggccgggcaggtgctgtcc
cggccggaggggaggctgcccgcgcccccgccccgggacctgctgcgcatccaggaggag
acggaccgcctggcgcaggagctccgggacgtgcggggcaaccagcagtccctgcaggtc
cagctgcaccagctgcggctgcacgctgccgtgctgggccagggccacagcccgccgttg
gcagccgcccacgccgatgggccctcggaaaggatccccctgctccagccccccgggggc
ccgcaccaggacctgagagtcaactttgtggcaggtgccgtggagccctccaaggccgcc
gccctcgaacgcctgctctggagggcctgtcgtggcttccttatcgccagcttccgggag
acagaacaacagctcgaggaccccgtgacgggcgagccttcgacgtggatgaccttcctc
atctcctactggggcgagcagatagggcagaagatccgcaagatcacggactgcttccac
tgccacatctttccgtacgcggagcacgaggagggccgcctcgcggccctgcagcaggtg
cagcagcagagccacgagctgcaggaggtcctgggggagacggagcgcttcctgagccag
gtgctggcccgcgtgcagcagctgctgccgccctggcaggtgcagatccgcaagatgaag
gccgtgtacctggccctcaaccagtgcagcgtgagcgccacgcacaagtgcctcatcgcc
gagggctggtgtgccgcgcgcgacctgcccaccctacagcaggcgctgcaggacagctcg
agcgaggcaggggtgagtgccgtggttcaccgcatcccctgccgggacatgccccccacg
ctcatccgcaccaactgcttcacggccagcttccaaggcatcgtggacgcctacggcgtg
ggtcgctaccaggaggtcaatcccgcaccctacaccatcatcaccttccccttcctcttt
gccgtaatgttcggcgacgtgggccacgggctgctcatgttcctcttcgccttggccatg
gtgctcacggagaaccagccggccgtgaagtcggcgcagaacgagatctggcagaccttc
ttcagcggccgctacctgctcctgctcatgggcctgttctccgtctacaccggcttcatt
tacaacgagtgcttcagccgcgccactgccatcttctcctccggctggagcgtggcggcc
atggccacccagtcggactggagtgacgcgttcctggcccagcacccgctgctcgccctg
gaccccaacgtcagcggcgtcttcctgggaccctaccccttcggcatcgaccccatctgg
agcctggccgtcaaccacctgagcttcctcaactccttcaagatgaagatgtccgtcatc
ctaggggtcacccacatgaccttcggggtggtcctgggagtcttcaaccacgtgcacttc
ggccagtggcaccggctgctcctagagaccctgccggagctggtcttcctgctggggctc
ttcggctacctggtcttcctcatcgtctacaagtggctgcaagattacgccgccagggct
gcctcggcccccagcatcctcatccacttcatcaacatgttcctcttctcccacagcccc
accaaccagcccctcttccacgggcaggaagcggtgcagtcagcactggtgatcctggcc
ctggtcatggtgcccgtcctgctgctcggcaccccgctgttcctgcactggcggcaccgc
agccgctcgcagagggggcccgctggccgacagccggatgaggacaagtccgggattctg
gactcctccgatgcatccgtggccggctggggccctgatgaggagaaagcggggtgcccg
gaggacggagaggaggccgagtttgtcctgtccgaggtgttgatgcaccaggccatccac
accatcgagttctgcctgggctgcatctccaacacggcctcttacctgcgcctctgggcc
ttgagcttggcccacgcccagctgtccgaggtcctgtgggccatggtgatgcgctcgggc
ctgggcctgggccgcaagttgggcgtggcagccgtggcactggtccccatcttcgccgcc
ttcgccgtgttgaccgtggctatcctgctggtgatggaggggctctcggccttcctgcac
gcgctgcggctgcactgggtggagtttcagaacaagttctactcaggcactggctacaag
ctgagccccttcaccttcgcttcagaggagggctag

KEGG   Felis catus (domestic cat): 101084001
Entry
101084001         CDS       T02385                                 
Symbol
ATP6V1C1
Name
(RefSeq) V-type proton ATPase subunit C 1
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084001 (ATP6V1C1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101084001 (ATP6V1C1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084001 (ATP6V1C1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101084001 (ATP6V1C1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101084001 (ATP6V1C1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084001 (ATP6V1C1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101084001 (ATP6V1C1)
SSDB
Motif
Pfam: V-ATPase_C Folliculin
Other DBs
NCBI-GeneID: 101084001
NCBI-ProteinID: XP_011289721
Ensembl: ENSFCAG00000005022
LinkDB
Position
F2:50892750..50940546
AA seq 382 aa
MTEFWLISAPGEKTCQQTWEKLHAATTKNNNLAITSKFNIPDLKVGTLDVLVGLSDELAK
LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
ISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSE
YLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKAL
RVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYELYKHLDSSAAAIIDAPMDIPGLN
LSQQEYYPYVYYKIDCNLLEFK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgactgagttctggcttatatctgctcctggggagaaaacatgtcagcaaacatgggag
aaattgcatgcagcaactacaaagaacaataatcttgctattacttcaaaatttaacatt
cctgacttaaaggttggcacactggatgtcttggttggtttgtcagatgaactggctaaa
ctggatgcatttgtagaaggggtggttaagaaagtggctcaatatatggctgatgtatta
gaagatagtaaagataaagttcaggagaatctgttggccaacggagttgacttggttact
tatataacaaggtttcagtgggacatggctaaatacccaatcaagcagtccctgaaaaat
atttctgaaataattgccaagggagtgactcagattgacaatgacctgaaatctagagca
tccgcatataataacttgaaagggaatcttcagaatttggaacggaagaatgcaggaagt
ttgctaactagaagtttagcagaaattgtgaagaaggatgactttgttcttgattcagag
tatctcgtcacattactggtcgtggttcccaagttaaaccacaacgactggattaagcag
tatgaaacactagctgaaatggtagttccaaggtctagcaatgtactctcagaggaccaa
gacagttacctttgcaatgtcaccttgtttaggaaggcagttgatgacttcagacacaaa
gccagggaaaacaaattcatcgttcgtgacttccagtataatgaagaggagatgaaagca
gataaagaagaaatgaacaggctttctactgacaagaaaaagcagtttggaccacttgta
cggtggctgaaagtaaatttcagtgaggcgtttattgcgtggattcatgtgaaagcgttg
agagtttttgttgagtctgtcttaaggtatggcttgcctgtgaacttccaagcaatgctc
cttcagcccaataagaaaacaatgaagaaactaagagaagtattatatgaattgtataaa
catctagacagcagtgcggcagctattattgatgctcctatggatattccaggcttaaac
ctgagtcagcaggaatactacccctatgtgtactacaagattgattgcaacttgctggaa
ttcaagtaa

KEGG   Felis catus (domestic cat): 101084376
Entry
101084376         CDS       T02385                                 
Symbol
ATP6V0B
Name
(RefSeq) V-type proton ATPase 21 kDa proteolipid subunit isoform X1
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04142  Lysosome
fca04145  Phagosome
fca04721  Synaptic vesicle cycle
fca05152  Tuberculosis
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084376 (ATP6V0B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084376 (ATP6V0B)
   04142 Lysosome
    101084376 (ATP6V0B)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101084376 (ATP6V0B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084376 (ATP6V0B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084376 (ATP6V0B)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101084376 (ATP6V0B)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 101084376
NCBI-ProteinID: XP_003990055
Ensembl: ENSFCAG00000006489
UniProt: M3W601
LinkDB
Position
C1:34745710..34749080
AA seq 205 aa
MTGLALLYSGVFVAFWACMLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA
TDPQAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQTSRVKMGD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacggggctagcgctgctctactccggggtcttcgtggccttttgggcctgcatgctc
gtcgtgggaatctgctacaccatttttgacttgggtttccgctttgatgtggcatggttc
ctgactgagacttcccccttcatgtggtcaaacttgggcattggtctggctatctccctg
tctgtggttggggcagcatggggcatctatattactggctcttctatcattgggggaggg
gtgaaggcccccaggatcaagaccaagaacctggtcagcatcatcttctgtgaggctgtg
gccatctatggcatcatcatggcaattgtgattagcaacatggctgagcctttcagtgcc
actgacccccaggccattggacatcgaaactaccatgcaggctactccatgtttggggca
ggcctcacagtgggcctgtctaatctcttctgtggagtctgcgtgggcatcgtgggcagt
ggagctgccctggctgatgcacagaaccccagcctctttgtaaagattctcatcgtggag
atctttggcagtgccattggcctctttggggtcattgttgcaatccttcagacctcgaga
gtgaagatgggtgactag

KEGG   Felis catus (domestic cat): 101084539
Entry
101084539         CDS       T02385                                 
Symbol
ATP6V1G2
Name
(RefSeq) V-type proton ATPase subunit G 2 isoform X1
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084539 (ATP6V1G2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101084539 (ATP6V1G2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084539 (ATP6V1G2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101084539 (ATP6V1G2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101084539 (ATP6V1G2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084539 (ATP6V1G2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101084539 (ATP6V1G2)
SSDB
Motif
Pfam: V-ATPase_G Zein-binding Josephin
Other DBs
NCBI-GeneID: 101084539
NCBI-ProteinID: XP_003985962
Ensembl: ENSFCAG00000029881
UniProt: A0A337S9H0
LinkDB
Position
B2:complement(32555552..32558160)
AA seq 118 aa
MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEHYRREREQEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIAA
NT seq 357 nt   +upstreamnt  +downstreamnt
atggccagtcagtctcagggtatccagcagctcctgcaagctgagaagcgggcggctgag
aaggtggcagatgccagaaagaggaaggcccggcgtctgaagcaggcaaaggaggaggcc
cagatggaggtggagcattaccgtcgagagcgagagcaggaattccagagcaagcagcag
gcggccatgggctcccaggggaacctctcagctgaggtggagcaggctacgagacgccag
gtacagggcatgcagagctcccagcagagaaaccgtgaacgcgtcctggcccaacttctt
ggcatggtctgtgacgtcaggccccaggtccaccccaactaccggattgctgcctag

KEGG   Felis catus (domestic cat): 101084995
Entry
101084995         CDS       T02385                                 
Symbol
ATP6V0A2
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a isoform X1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04142  Lysosome
fca04145  Phagosome
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05152  Tuberculosis
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084995 (ATP6V0A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101084995 (ATP6V0A2)
   04142 Lysosome
    101084995 (ATP6V0A2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101084995 (ATP6V0A2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101084995 (ATP6V0A2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101084995 (ATP6V0A2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101084995 (ATP6V0A2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101084995 (ATP6V0A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084995 (ATP6V0A2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101084995 (ATP6V0A2)
SSDB
Motif
Pfam: V_ATPase_I Takusan CENP-F_leu_zip
Other DBs
NCBI-GeneID: 101084995
NCBI-ProteinID: XP_003994656
Ensembl: ENSFCAG00000003773
LinkDB
Position
D3:complement(6294005..6338366)
AA seq 854 aa
MGSLFRSETMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILAYLVQEINRADIPLPEGETSPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPPLENDSLLDYSCMQRLGAKLGFVSGLI
NQGKVEAFEKMLWRVCKGYTIVTYAELDEPLEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHVYPYPNTAEERKEIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSHVI
QVKKMKAIYHMLNMCSFDVTNKCLIAEVWCPEADLHELRRALEEGSRESGATIPSFMNTI
PTKETPPTLIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFAVMFGDFGHGFV
MFLFALLLVLNENHPRLNQSQEIMRMFFNGRYILLLMGLFSVYTGLIYNDCFSKSVNLFG
SGWSVSAMYSSSHTPAEQKKMGLWNDSVVRHNRVLQLDPSIPGVFQGPYPLGIDPIWNLA
TNRLTFLNSFKMKMSVILGIIHMTFGVILGIFNHLHFRKKFNIYLVSVPELLFMLCIFGY
LIFMIVYKWLVYSAETSRVAPSILIEFINMFLFPASETNGLYSGQGHVQRLLLAVTALSV
PVLFLGKPLFLLWLHNGRSCFGVSRSGYTLVRKDSEEEVSLLGSQDIEEGNNQIEDGYRE
MMCEEFNFGEILMTQVIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWTMLVRVGLR
VDTTYGVLLLLPVIALFAVLTIFILLIMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFRLLSSKFSDDVA
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggggtccctgttccggagcgagaccatgtgcctggcgcagctcttcctgcagtccggc
acggcctacgagtgcctcagcgccctgggcgagaagggcctggtccagttccgagacctc
aaccagaatgtaagttccttccaaagaaaatttgttggtgaggtgaagaggtgtgaagaa
ctggaacgaatattagcatatttggtacaggaaattaatagagctgatattcccctgcct
gagggagagaccagtcctcctgcaccccctctgaaacaagtcctagaaatgcaggagcag
ctgcagaagctcgaggttgagctgagagaagtcaccaagaacaaggagaaactgaggaag
aacctgcttgaactgattgagtacactcacatgctcagagtgacaaaaaccttcgttaaa
cgaaacgtggagtttgaacctacttatgaagaattccctcccttagagaatgattcctta
ttggactacagctgtatgcagaggctgggagcaaaactggggtttgtatctggcctaatt
aaccaagggaaagttgaagcatttgagaaaatgctgtggagggtctgcaaagggtatacc
atcgtgacctatgcagaactggatgagcccctcgaggaccctgaaactggagaagtcata
aagtggtatgtgtttttaatatccttttggggagagcagattggccacaaggttaagaag
atatgtgattgttaccactgccatgtttacccctacccgaatacagctgaggagcggaag
gagattcaggaggggctcaatacccggattcaggatctctacactgtgctccacaaaacc
gaggattatttaaggcaagtgctgtgtaaagccgccgaatccgtctacagccacgtcatc
caggtgaagaagatgaaagccatttaccacatgctgaacatgtgcagcttcgacgtgacc
aacaagtgcctcatcgccgaagtctggtgtcctgaggccgatctgcacgagctgcgccgg
gcgctcgaggaggggtcgagagagagcggtgctacaatcccctcatttatgaacaccatc
ccaacaaaagaaacccccccgactctaatccgcaccaacaaattcactgagggctttcag
aacattgtggacgcctatggagtcgggagctacagagaagtgaacccagctctcttcacc
atcatcactttccccttcctgttcgccgtgatgttcggagacttcggacatggcttcgtg
atgttcttgtttgccctcttgctggtgttaaatgaaaaccaccccagactaaatcagtca
caagagatcatgcgcatgtttttcaatggccgatacatcctcctgctgatggggctgttc
tccgtgtacacgggcctcatctacaacgactgcttttcaaagtcggtcaacctgttcggc
tctgggtggagcgtgtcagccatgtacagctccagccacacccctgcggagcagaagaag
atggggctttggaatgacagcgtcgtcaggcacaacagggttttgcagttggacccgagc
attcctggagtgttccaaggcccttaccctcttggtatcgatcccatttggaacttggcc
acaaatcgcctcactttcctaaactctttcaaaatgaaaatgtctgtgattttaggaatt
attcacatgacttttggagtcattctgggaatatttaaccacttgcatttccggaagaag
ttcaatatttatttggtttctgtcccggaacttctctttatgctgtgcatctttggatac
cttatatttatgatcgtctataagtggctggtttattcggcagaaacctccagagtcgct
cccagcattctgattgaatttattaacatgtttttattcccggctagtgaaacgaatggt
ctttactcagggcaggggcacgtccagaggctgctgctggccgtcacggcgctgtccgtt
cccgttctcttcttgggaaaaccactcttcttgctgtggctccacaacgggcgcagctgc
tttggcgtgagccggagtggttacacactcgtaaggaaagacagcgaggaagaagtttct
ctactgggaagccaagacatagaagagggaaataaccaaatagaagatggatatagagaa
atgatgtgtgaagagtttaattttggagagatactgatgacccaagtgattcattccatc
gagtactgtctggggtgcatctccaacaccgcttcatacctgaggctctgggctctcagc
ctggcccacgcacagctgtctgacgtcctgtggaccatgctggtgcgcgtgggcctccgg
gtagacaccacttacggagtcttgctgctgctaccagtaatcgctctctttgcagtgttg
acaattttcatccttttgatcatggaaggcctttctgcatttctccatgccatacgcctc
cactgggtagaatttcagaacaagttctacgttggtgcaggcaccaagtttgttcctttc
tcattcagactactttcgtcgaagttcagtgacgacgtggcatga

KEGG   Felis catus (domestic cat): 101086301
Entry
101086301         CDS       T02385                                 
Symbol
ATP6V1C2
Name
(RefSeq) LOW QUALITY PROTEIN: V-type proton ATPase subunit C 2
  KO
K02148  V-type H+-transporting ATPase subunit C
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101086301 (ATP6V1C2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101086301 (ATP6V1C2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101086301 (ATP6V1C2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101086301 (ATP6V1C2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101086301 (ATP6V1C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101086301 (ATP6V1C2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101086301 (ATP6V1C2)
SSDB
Motif
Pfam: V-ATPase_C FliD_N
Other DBs
NCBI-GeneID: 101086301
NCBI-ProteinID: XP_023107877
Ensembl: ENSFCAG00000009257
LinkDB
Position
A3:complement(135147569..135201396)
AA seq 427 aa
MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFSIPDFKVGTLDSLVGLSDELGKL
DTFAESLIKRMAQSVVEVMEDSKGKVPENLLANGVDLTSFVTHFEWDMAKYPAKQPLVSV
VDTLAKQLAQIETDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEY
LVTLLVIVPKPSYAQWQKTYESLSDMVVPRSTKLIAEDNEGGLFTVTLFRKVIDDFKTKA
KENKFTVREFYYDEKEIKREREELSRLLSDKKQQYQTSCVALKKGSSTFPDHKVQVTPLG
NPDRPAAGQTDREREXEGEGEGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVN
FQAVLLQPHKKSSTKRLREVLNSVFRHLDQVAAASVLDASVDIPGLQLGNQDYFPYVYFH
IDLSLLD
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcggagttttggttaatttctgcccccggcgataaggaaaacttacaagccctggag
aggatgaacacggtaacctccaagtccaacctgtcttataacaccaaattctcgattcct
gacttcaaggtggggaccttggattcccttgttggcctctctgatgagctggggaaactc
gatacctttgctgaaagcctcataaagaggatggcccagagcgtggtagaagttatggaa
gactccaaggggaaggttccggagaacctcctggccaacggagttgacttaacatccttc
gtgacccactttgagtgggacatggccaaatatcctgcgaagcagccactggtgagcgtc
gtggacactctagcaaagcaactggcacagatcgagaccgacctgaagtcccggacggcc
gcctacaacaccctgaagacaaacctggagaacctggagaagaaatccatgggaaacctc
ttcactcggacgctgagcgatattgtgagcaaagaagacttcgtgttggattccgagtat
cttgtcacacttctggtcatcgtgcccaaaccaagctacgcgcaatggcaaaaaacctac
gaatccctctcggacatggtggtccctcggtcgactaaactgatcgccgaggacaacgag
ggcggcctcttcacggtgaccctgtttcgaaaagtgatcgacgatttcaaaaccaaagcc
aaagagaacaagttcactgtccgtgaattttactatgatgagaaagagataaagagggaa
agggaagagctgagccgtttgctgtctgataagaagcaacagtatcaaacttcctgtgtt
gctcttaaaaagggatcatccaccttcccggaccacaaggttcaggtaaccccgctaggg
aaccccgataggcccgctgcggggcagacggacagagagagagagnntgagggcgaggga
gagggcccgctgctgcgctggctcaaggtgaacttcagcgaagccttcattgcctggatc
cacatcaaggccctgagggtgtttgtggagtccgtgctcaggtacggacttccagtgaat
ttccaggcggtgctcctccagcctcacaagaagtcctccaccaaacgtttaagagaggtt
ctgaactctgtcttcagacatctggatcaagtagcggctgcaagcgtgttggatgcgtct
gtggacatcccgggactgcagctcggcaaccaagactactttccttacgtctatttccac
atcgacctcagcctgctcgactag

KEGG   Felis catus (domestic cat): 101089593
Entry
101089593         CDS       T02385                                 
Symbol
ATP6V0A4
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04142  Lysosome
fca04145  Phagosome
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05152  Tuberculosis
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089593 (ATP6V0A4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101089593 (ATP6V0A4)
   04142 Lysosome
    101089593 (ATP6V0A4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101089593 (ATP6V0A4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101089593 (ATP6V0A4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101089593 (ATP6V0A4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101089593 (ATP6V0A4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101089593 (ATP6V0A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101089593 (ATP6V0A4)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101089593 (ATP6V0A4)
SSDB
Motif
Pfam: V_ATPase_I Bacillus_HBL
Other DBs
NCBI-GeneID: 101089593
NCBI-ProteinID: XP_011278879
LinkDB
Position
A2:complement(155352147..155452359)
AA seq 840 aa
MASVFRSEEMCLSQLFLQVEAAYCCVAELGELGLVQFKDLNVNVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIAVQLPEKAPPTPLPREMITLETLLEKLEGELQEASQNQQALKKS
FLELTELKHLLKKTQDFFETETSLADDFFTEDTSGLLELRATPAYVTGKLGFTAGVINRE
RMASFERLLWRVCRGNIYLKFSEMDVTLEDPVTKEEIKKNIFIIFYQGEQLRQKIKKICD
GFRAIIYPCPEPAAERREMLAGINVKLEDLITVITQTESHRQRLLQEAAANWHSWVIKVQ
KMKAIYHILNMCNIDVTQQCVIAEIWFPVADTGRIKRALEQGMELSGSSMVPILTAVQSK
TSPPTFNRTNKFTAGFQNIVDAYGVGSYREINPAPYTIITFPFLFAVMFGDCGHGIIMLL
AALWMVLNERRLLSQKTNNEIWNTFFHGRYLILLMGIFSIYTGLIYNDCFSKSFNIFGSS
WSVRPMFRNGTWNAHVMETNPYLQLDPAIPGVYSGNPYPFGIDPIWNLASNKLTFLNSYK
MKMSVILGIVQMVFGVVLSLFNHVYFGRTLNIVLQFIPEMIFILCLFGYLVFMIIFKWCH
FDVHMSWHAPSILIHFINMFLFNYDDPSNAPLYRHQQEVQSFFVIMALISVPWMLLIKPF
ILRAKHQKSLLQASMIQEDATEDIESDNSSPSMSTGQRASAGGHGAQDDHEEEFNFGDIF
VHQAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVMNIGLRVRGWGGLIGVFI
IFAIFAVLTVAILLIMEGLSAFLHALRLHWVEFQNKFYVGAGYKFSPFSFKYILEGTSEE
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggcgtccgtgtttcgcagtgaggagatgtgtttgtcccagctgtttctccaggtggag
gctgcatattgctgtgtggctgagcttggggagcttggactggttcagttcaaagattta
aatgtgaatgtgaacagcttccaaagaaaatttgtgaatgaagtcagaaggtgtgagtcg
ctggagagaattctccgttttctggaagatgagatgcaaaatgagatcgcagttcaattg
ccagagaaagccccaccaacccctctcccacgggaaatgattaccctggagactcttcta
gaaaaactggaaggagaattacaggaagccagccagaaccagcaggctttaaagaaaagc
ttcctagaactgaccgaactcaaacatctcctgaagaaaacccaggacttcttcgagacc
gaaaccagcctagctgatgatttctttacggaggatacctctggcctcctggaattgaga
gccacacctgcatacgtgactggaaagctggggttcacggccggtgtgatcaacagggag
aggatggcttcctttgagaggctgctgtggagagtctgccgaggaaacatctacctgaag
ttcagtgagatggacgtgactctggaggatcccgtcacgaaagaagaaattaagaagaat
attttcatcatattttatcaaggagagcaactcagacagaaaatcaagaagatctgtgac
gggtttcgagccatcatatatccctgcccggagcctgcagcggagcgcagagagatgctg
gccggcatcaatgtgaagctggaagatttaatcaccgtcatcacacaaacagagtctcac
cgtcagcgcctcctccaagaagcagctgccaactggcactcctgggtcattaaagtgcag
aagatgaaagctatttaccacatcctgaacatgtgcaacattgacgtcacccagcagtgc
gtcattgctgaaatctggttcccggtggcagacactgggcgcatcaagagggcattagag
caaggcatggaactaagtggctcctccatggtccccatcctgactgcagtgcagtctaaa
acatctcctcccacatttaacaggaccaataaattcacagctggcttccagaatattgta
gatgcatatggtgtgggcagttaccgggaaataaacccagctccctataccatcatcaca
ttccccttcctcttcgctgtgatgtttggagactgtggtcatgggattatcatgctcctg
gcagccctttggatggtccttaatgagagacgcttgctctcccagaagaccaacaacgag
atctggaacaccttcttccacggacgctatctgattctccttatgggcatcttctccatc
tacacgggcttgatttacaatgactgcttctccaagtctttcaacatctttggctcttct
tggagtgtccgaccgatgttcagaaatggcacgtggaatgcacatgtaatggaaacaaat
ccgtatttacagctggacccagccattccaggagtgtactctggaaatccatacccattt
gggattgatccgatttggaacttggcttcaaacaaactaacgtttctgaactcctacaag
atgaagatgtcagttatcctgggaattgtccagatggttttcggtgttgttctcagcctt
ttcaatcatgtatacttcggaagaactctcaacatcgttctgcagtttattcctgagatg
attttcatcctgtgtctgtttggatacttggtcttcatgatcattttcaagtggtgccac
tttgatgtgcacatgtcctggcacgccccaagcatcctcatccacttcatcaacatgttt
ctgtttaactatgacgacccttccaacgcacccctgtacagacatcagcaagaagtccaa
agtttctttgttatcatggctttgatttctgtgccttggatgcttctgattaagccgttt
attcttagagccaagcatcaaaaatccctgctgcaggcatccatgatccaagaagatgcc
actgaggacattgaaagtgacaactccagcccttccatgagcacaggtcagagggcttct
gcaggtggccatggggctcaggatgaccatgaagaagagttcaactttggagacatcttt
gtgcatcaagccatccacacaatcgagtactgcctgggctgcatttcaaacacagcctct
tacctccggctctgggccctcagcttggctcatgcacaattgtctgaagtgctctggacc
atggtgatgaacattggccttcgtgtgcgaggctggggaggactcattggagtctttatc
atttttgccatatttgctgttctgacagtagccatccttctgatcatggagggtctctct
gcgttcctgcacgccctgcgactacactgggtggagttccagaacaagttctatgtcggg
gccggttacaagttttctcctttctcctttaaatacatcctggaagggacatcggaggaa
tag

KEGG   Felis catus (domestic cat): 101091205
Entry
101091205         CDS       T02385                                 
Symbol
ATP6V1D
Name
(RefSeq) V-type proton ATPase subunit D isoform X1
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04145  Phagosome
fca04150  mTOR signaling pathway
fca04721  Synaptic vesicle cycle
fca04966  Collecting duct acid secretion
fca05165  Human papillomavirus infection
fca05323  Rheumatoid arthritis
Module
fca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091205 (ATP6V1D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101091205 (ATP6V1D)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101091205 (ATP6V1D)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101091205 (ATP6V1D)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101091205 (ATP6V1D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101091205 (ATP6V1D)
  09163 Immune disease
   05323 Rheumatoid arthritis
    101091205 (ATP6V1D)
SSDB
Motif
Pfam: ATP-synt_D
Other DBs
NCBI-GeneID: 101091205
NCBI-ProteinID: XP_003987793
Ensembl: ENSFCAG00000011078
UniProt: M3WEF5
LinkDB
Position
B3:complement(115508938..115531676)
AA seq 247 aa
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVMEPANLLAEEK
DEDLLFE
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtcgggcaaagaccgaattgaaatctttccctcgcgcatggcacagaccatcatgaag
gctcgattaaaaggagcacagacaggtcgaaacctcctgaagaaaaaatctgatgcctta
actcttcgatttcgacagatcctaaagaagataatagagactaaaatgttgatgggtgaa
gtgatgagagaagctgccttttcacttgcagaggccaagttcacggcaggggacttcagc
accacagtaattcaaaatgtaaataaagcccaagtgaagattcgagctaagaaagataat
gtagcaggggttactttgccagtgttcgaacattaccatgaaggaactgacagttatgaa
ctgactggtttagccagaggtggggaacaattggctaaattaaagaggaactatgccaaa
gcagtggaattactggtggaactggcttcacttcagacttcctttgttactttggatgaa
gctattaagataaccaacaggcgtgtaaatgccattgaacatgtcatcattccccggatc
gaacgtacccttgcttatatcatcacagagctggatgagagagagcgagaagagttctat
aggttaaagaaaatccaagagaagaaaaagattctcaaggaaaaatcagagaaggacttg
gaacagcggcgggcagccggagaggtgatggagcctgctaatcttttggctgaagagaag
gatgaggatcttttgtttgaatag

DBGET integrated database retrieval system