KEGG   Felis catus (domestic cat): 101081858
Entry
101081858         CDS       T02385                                 
Symbol
ATP1B1
Name
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101081858 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    101081858 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101081858 (ATP1B1)
   04918 Thyroid hormone synthesis
    101081858 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    101081858 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    101081858 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101081858 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    101081858 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    101081858 (ATP1B1)
   04971 Gastric acid secretion
    101081858 (ATP1B1)
   04972 Pancreatic secretion
    101081858 (ATP1B1)
   04976 Bile secretion
    101081858 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    101081858 (ATP1B1)
   04974 Protein digestion and absorption
    101081858 (ATP1B1)
   04978 Mineral absorption
    101081858 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101081858 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101081858 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    101081858 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101081858 (ATP1B1)
CD molecules [BR:fca04090]
 Proteins
  101081858 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 101081858
NCBI-ProteinID: XP_011289201
UniProt: M3WB86
LinkDB
Position
F1:13682462..13706265
AA seq 303 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFQPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQKDE
MIFEDCGNVPSEIKERGEFNNERGERKVCRFKLEWLGNCSGINDETYGYKEGKPCVLIKL
NRVLGFKPKPPKNESSEAYPVMKYNPYVLPVQCTGKRDEDKDRVGNVEYFGLGGYAGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAFGENIGYSEKDRFQGRFDVKIE
VKS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcccgcggaaaagccaaggaggagggcagctggaagaaattcatctggaactcggag
aagaaggagtttctgggcaggaccggcggcagctggtttaagatccttctgttctacgtg
atcttttatggctgcctggctggcatcttcatcggaaccatccaagtgatgctgcttacc
atcagcgaattccagcccacataccaggaccgggtggcccccccaggattaacacagatt
cctcagatccaaaagactgaaatttcctttcgcccgaacgaccccaagagctatgaggca
tatgtgctcaacatagttaggttcctggagaagtacaaagattcagcccagaaggatgaa
atgatttttgaagattgtggcaatgtgcccagcgaaatcaaggaacggggagaattcaac
aacgaacggggagagcggaaagtgtgcaggttcaagctcgagtggttgggaaattgctcc
ggaataaacgatgagacttacggctacaaagagggcaaaccgtgtgtcctcataaagctc
aaccgagttctgggcttcaaacctaagcctcccaagaatgagtcgtcggaggcgtaccca
gtgatgaagtataatccctacgtcctgcccgtccagtgcaccggcaagcgagacgaagac
aaggacagagttgggaacgtggagtacttcggcctgggcggctacgccggcttccccctg
cagtactacccctactacggcaagctgctgcagcccaagtacctgcagcccctgctggcc
gtgcagttcaccaacctgaccatggacactgagatccgcatcgagtgcaaggcgttcggt
gagaacatcgggtacagcgagaaggaccgtttccagggacgctttgatgtaaagattgaa
gttaagagctga

KEGG   Felis catus (domestic cat): 101083636
Entry
101083636         CDS       T02385                                 
Symbol
ATP1A3
Name
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101083636 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    101083636 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101083636 (ATP1A3)
   04918 Thyroid hormone synthesis
    101083636 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    101083636 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    101083636 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101083636 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    101083636 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    101083636 (ATP1A3)
   04971 Gastric acid secretion
    101083636 (ATP1A3)
   04972 Pancreatic secretion
    101083636 (ATP1A3)
   04976 Bile secretion
    101083636 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    101083636 (ATP1A3)
   04974 Protein digestion and absorption
    101083636 (ATP1A3)
   04978 Mineral absorption
    101083636 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101083636 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101083636 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    101083636 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083636 (ATP1A3)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     101083636 (ATP1A3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101083636 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   101083636 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   101083636 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   101083636 (ATP1A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 101083636
NCBI-ProteinID: XP_023100947
Ensembl: ENSFCAG00000012729
LinkDB
Position
E2:complement(13098209..13118768)
AA seq 1031 aa
MGPRMESGGSDSYRVATSQDKKDDKGSPKKSKGTKDRRDLDDLKKEVAMTEHKMSVEEVC
RKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCF
LAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVI
REGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCT
HDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFI
QLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFD
KSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRE
RNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDE
EMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMI
DPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPV
SQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIV
AVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNL
KKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIM
KRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSNLVGIRLNWDD
RTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNK
ILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRN
PGGWVEKETYY
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgggcccaaggatggagtctggtggctctgacagctatcgtgtcgccacctcgcaggac
aagaaagatgacaagggctcgcccaagaagagcaagggcaccaaagaccgcagggacctg
gatgacctcaagaaggaggtggctatgacagagcacaagatgtccgtggaagaggtctgc
cggaaatacaacacagactgcgtgcagggtctgacccacagcaaagcccaggagatcctg
gcccgggatgggcctaacgcgctcacaccaccacccaccaccccagaatgggtcaagttc
tgccgccagctcttcgggggcttctcaatcctgctgtggatcggagccatcctctgcttc
ctggcctatggcatccaggccggcacagaggacgatccctctggcgacaacctgtacctg
ggcatcgtgctggcagccgtggtcatcatcaccggctgcttctcctactaccaggaggcc
aagagctccaagatcatggagtccttcaagaacatggttccccagcaagccctggtgatc
cgggagggtgagaagatgcaggtgaacgctgaggaggtggtggtcggggacctggtggag
atcaagggtggagaccgagtcccggccgacctgcgaatcatctcagcccacggttgcaag
gtggacaactcctccctgactggtgaatcagagccccagacccgctctcccgactgcaca
cacgacaaccccttggagactcggaacatcaccttcttttccaccaactgcgtggaaggc
acggctcgaggtgtggtggtggccacaggtgaccgcactgtcatgggccgcattgccacc
ctggcttcggggctggaggtgggcaagacgcccatcgccattgagatagagcacttcatc
cagctcatcaccggcgtggctgtcttcctgggcgtctctttcttcatcttgtccctcatc
ctcggatacacctggcttgaggctgtcatcttcctcatcggcatcatcgtggccaatgtc
ccggagggcctgctggccactgtcactgtgtgtctgacgctgaccgccaagcgcatggct
cggaagaactgccttgtgaaaaacctggaggccgtggagaccctgggctccacatccacc
atttgctcggacaagacggggaccctcacccagaaccgcatgacggttgcccacatgtgg
tttgacaaccagatccatgaggctgacaccactgaggaccagtcagggacctcgttcgac
aagagctcgcacacctgggtagccctgtcccacatcgccggactctgcaaccgtgccgtc
ttcaagggaggtcaggacaacatccccgtgctcaagagggacgtggccggcgatgcctca
gagtccgccctgctcaagtgcatcgagttgtcctccggctccgtgaagctgatgcgtgaa
cggaacaagaaagtggccgagattcccttcaattctaccaacaaataccagctctccatc
cacgagaccgaggaccccaacgacaaccgatacctgctggtgatgaagggcgcccccgag
cgcatcctggaccgctgctccaccatcctgctgcagggcaaggaacagccactggacgag
gagatgaaggaggccttccagaatgcctacctcgagctcggcggcctgggcgaacgagtg
ctcggtttctgccattactacctgcccgaggagcagttccccaagggctttgcctttgac
tgtgacgatgtgaactttaccacggacaacctctgcttcgtcggcctcatgtccatgatc
gacccgccccgggccgccgtccccgacgcagtgggcaagtgccgcagcgccggcatcaag
gtcatcatggtcacgggtgatcaccccatcacggcaaaggccatcgccaagggcgtgggc
atcatctccgagggcaacgagactgtggaggacatcgctgcccggctcaacattcccgtc
agccaggtcaacccccgggatgccaaggcctgtgtgatccatggcaccgacctcaaggac
ttcacctctgagcaaatcgatgagatcctgcagaaccacacggagatcgtctttgcccgc
acgtccccccaacagaagctcatcatcgtggagggctgtcagagacagggagcaatcgtg
gccgtgactggcgatggcgtgaatgactcccctgccctgaagaaggcagacatcggtgtg
gccatgggcattgccggctctgacgtgtccaagcaggcagcggacatgattctgctggac
gacaactttgcctccatcgtcacgggtgtagaagagggccgcctgattttcgacaacctg
aagaaatccatcgcctacaccctgaccagcaacattcctgagatcacacccttcttactg
ttcatcatggccaacatcccgctgcctctgggcaccatcaccatcctctgcatcgacctg
ggcactgacatggtccctgccatctccttggcatacgaggctgcggagagtgacatcatg
aagagacagcccaggaacccacgcacggacaagctggtcaatgagaggctcatcagcatg
gcctacgggcagattggaatgatccaggctctcggtggcttcttttcctactttgtgatc
ctggcagaaaatggcttcttgcccagcaacctggtgggcatccggctgaactgggatgac
cgaaccgtcaatgacctggaggacagttacgggcagcagtggacatacgagcagaggaag
gtggtggagttcacgtgccacacggccttcttcgtgagcatcgtggtcgtgcagtgggcc
gacctgatcatctgcaagacccggaggaactccgtcttccagcagggcatgaagaacaag
atcctcatcttcgggttgtttgaggagacggccctcgctgccttcttgtcctactgccca
ggcatggacgtggccctccgcatgtaccctctcaagcccagctggtggttctgtgccttc
ccctacagtttcctcatcttcgtctacgatgagatccgcaaactcatcctgcgcaggaac
cccgggggttgggtggagaaggaaacctactactga

KEGG   Felis catus (domestic cat): 101083695
Entry
101083695         CDS       T02385                                 
Symbol
ATP1A1
Name
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101083695 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    101083695 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101083695 (ATP1A1)
   04918 Thyroid hormone synthesis
    101083695 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    101083695 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    101083695 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101083695 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    101083695 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    101083695 (ATP1A1)
   04971 Gastric acid secretion
    101083695 (ATP1A1)
   04972 Pancreatic secretion
    101083695 (ATP1A1)
   04976 Bile secretion
    101083695 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    101083695 (ATP1A1)
   04974 Protein digestion and absorption
    101083695 (ATP1A1)
   04978 Mineral absorption
    101083695 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101083695 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101083695 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    101083695 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083695 (ATP1A1)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     101083695 (ATP1A1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101083695 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   101083695 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   101083695 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   101083695 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 101083695
NCBI-ProteinID: XP_011283388
Ensembl: ENSFCAG00000013378
LinkDB
Position
C1:99903823..99933842
AA seq 1021 aa
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKSSATWLALS
RIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRDRYTKIVEIPF
NSTNKYQLSIHKNPNTSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLYLPDEQFPEGFQFDTDDVNFPVENLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPTHLLGLRVDWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggggaaaggggttggacgtgataaatatgaacctgcggctgtttcagagcatggcgac
aaaaagaaggccaagaaagagagggatatggatgaattgaagaaagaagtttctatggat
gaccataaacttagccttgacgaacttcaccgcaaatatggaacagacctgagccgaggc
ttaacaaccgctcgagctgctgagatcctggcccgagacggccccaacgccctcacccca
ccgcccaccactcccgaatgggtcaagttctgtcggcaactgtttggggggttctcaatg
ttgctgtggattggagcgattctttgtttcttagcttacggcatccaggccgccacagaa
gaggaacctcaaaatgataacctgtatcttggcgtggtcctctccgctgtcgtcatcata
actgggtgtttctcctactatcaagaggctaaaagttcaaagatcatggaatccttcaaa
aacatggtccctcagcaagcccttgtgattcgaaacggtgagaaaatgagcatcaatgcc
gaggaggttgtagtcggggatctggtggaagtgaaaggaggagaccgaatccccgccgat
ctcagaatcatatctgccaacggctgcaaggtggacaactcctcgctcactggcgaatca
gagccccagaccaggtctccggacttcacaaatgaaaaccccctggagacgaggaacatc
gccttcttttcaaccaactgtgtggaaggcaccgcacgtggcattgtcgtgtacactggg
gatcgcacggtgatgggaagaatcgcgacactcgcgtccgggctggaaggcggccagacc
cccatcgctgccgaaattgagcattttatccacatcatcacgggtgtggctgtgttcctg
ggtgtgtccttcttcattctttctctgatcctcgagtacacctggctcgaggccgtcatc
tttctcatcggtatcattgtagccaacgtgccagagggtttgctggccactgtcacggta
tgtctgaccctcactgccaaacgcatggcaaggaaaaactgcttggtgaagaacttagaa
gccgtggagaccttggggtctacgtccaccatctgctcggataaaactggaaccctcacc
cagaaccggatgacagtggcccacatgtggttcgacaatcagatccacgaagccgacacg
acagagaatcagagcggtgtgtcgttcgacaagagttcagccacctggctcgctctgtcc
aggatcgcgggtctttgtaacagggcggtgtttcaggctaaccaggaaaacctgcctatc
ctcaagcgggcagttgcaggcgacgcctcggagtccgcgctcttgaaatgcattgagctg
tgctgtggctctgtgaaggagatgagagacagatacaccaaaatcgtggagatacccttc
aactccaccaacaagtaccagctgtccatccataagaaccccaacacgtctgagccccgg
cacctgctggtgatgaagggcgccccggagaggatcctggaccgctgtagctccatcctc
ctgcacggcaaggagcagcccctggacgaggagctgaaggacgcctttcagaacgcctac
ctggagctaggtggcctcggagagcgtgtgctaggtttctgccacctttatctgccagac
gaacagtttcctgaaggcttccagtttgacactgatgatgtgaatttccctgtggaaaac
ctctgcttcgtggggctcatctccatgatcgatcctcctcgggctgctgttcccgatgcc
gtgggcaaatgccgaagtgctggaattaaggttataatggtcactggagaccaccccatc
acagccaaagccattgccaagggtgtgggcatcatctcagaaggcaacgagaccgtggaa
gacattgctgcccgcctcaacatcccagtgagccaggtgaaccccagagatgccaaggcc
tgcgtggtccacggaagcgacctgaaggacatgacctccgagcagctggatgacattctg
aagtaccacacggagatcgtgtttgccaggacctctcctcagcagaagcttatcatcgtg
gaaggctgccagagacagggggctatcgtggccgtgactggcgatggtgtgaatgactct
ccagccttgaagaaggcagacatcggggttgccatggggatcgctggctctgacgtgtct
aagcaagctgccgacatgattcttctggatgacaactttgcgtccattgtgactggagtc
gaagaaggtcgtctgatctttgataacttgaagaaatccattgcctacaccctgaccagt
aacattccagagatcacccccttcctgatatttattattgcaaacattccactaccactg
gggaccgtcaccatcctctgcattgacttgggcacggacatggttcctgccatctccctg
gcttacgagcaagctgagagcgacatcatgaagagacagcccagaaaccccaagacggac
aagcttgtgaacgagcggctgatcagcatggcctacgggcagatcgggatgatccaggct
ctgggaggcttcttcacttacttcgtgatcctggctgagaacggcttcctcccgacccac
ctgctggggctccgcgtggactgggatgaccgctggatcaacgacgtagaggacagctac
gggcagcagtggacgtacgaacagaggaaaatcgtggagttcacttgccacacggccttc
ttcgtcagcatcgtggtggtgcagtgggctgacctggtcatctgtaagacccggaggaac
tctgtcttccagcaggggatgaagaacaagatcttaatattcggcctctttgaagagacg
gcccttgctgccttcctttcctactgccctggaatgggcgtggccctgaggatgtacccc
ctcaaacctacctggtggttctgtgccttcccctactctcttctcatcttcgtgtacgac
gaagtccgaaaactcatcatcaggcgacgccctggcggctgggtagagaaggaaacctac
tactag

KEGG   Felis catus (domestic cat): 101087093
Entry
101087093         CDS       T02385                                 
Symbol
FXYD2
Name
(RefSeq) sodium/potassium-transporting ATPase subunit gamma isoform X2
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101087093 (FXYD2)
   04022 cGMP-PKG signaling pathway
    101087093 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101087093 (FXYD2)
   04918 Thyroid hormone synthesis
    101087093 (FXYD2)
   04919 Thyroid hormone signaling pathway
    101087093 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101087093 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    101087093 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    101087093 (FXYD2)
   04972 Pancreatic secretion
    101087093 (FXYD2)
   04976 Bile secretion
    101087093 (FXYD2)
   04973 Carbohydrate digestion and absorption
    101087093 (FXYD2)
   04974 Protein digestion and absorption
    101087093 (FXYD2)
   04978 Mineral absorption
    101087093 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101087093 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101087093 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    101087093 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101087093 (FXYD2)
   04147 Exosome [BR:fca04147]
    101087093 (FXYD2)
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   101087093 (FXYD2)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101087093 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 EphA2_TM
Other DBs
NCBI-GeneID: 101087093
NCBI-ProteinID: XP_003992447
UniProt: A0A2I2U2J8
LinkDB
Position
D1:complement(15511698..15518809)
AA seq 64 aa
MDRWYLGGNPKGDVDPFYYDYETVRNGGLIFAALAFVVGLIIILSKRLRCGGRKKHRQVN
EDEL
NT seq 195 nt   +upstreamnt  +downstreamnt
atggacaggtggtacctgggtggcaaccccaaaggggatgtggacccattctactacgac
tacgagaccgtccgcaatggaggcctgatctttgctgccctggcctttgtcgtggggctc
atcatcatcctcagcaaaagactccgctgtgggggcagaaagaaacaccggcaagtcaac
gaagatgagctgtaa

KEGG   Felis catus (domestic cat): 101087210
Entry
101087210         CDS       T02385                                 
Symbol
ATP1B4
Name
(RefSeq) LOW QUALITY PROTEIN: protein ATP1B4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101087210 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    101087210 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101087210 (ATP1B4)
   04918 Thyroid hormone synthesis
    101087210 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    101087210 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    101087210 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101087210 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    101087210 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    101087210 (ATP1B4)
   04971 Gastric acid secretion
    101087210 (ATP1B4)
   04972 Pancreatic secretion
    101087210 (ATP1B4)
   04976 Bile secretion
    101087210 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    101087210 (ATP1B4)
   04974 Protein digestion and absorption
    101087210 (ATP1B4)
   04978 Mineral absorption
    101087210 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101087210 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101087210 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    101087210 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101087210 (ATP1B4)
CD molecules [BR:fca04090]
 Proteins
  101087210 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase DUF4746 Gcd10p
Other DBs
NCBI-GeneID: 101087210
NCBI-ProteinID: XP_006944034
Ensembl: ENSFCAG00000014941
LinkDB
Position
X:100915971..100937871
AA seq 357 aa
MRRQLRSRRAPASPYGYRYRLDDQDEVNQNYLADEEEEAEEEARVMVVPDLEEEEEEKDG
QEEEEEEIEEEKEEEEGQGPPTGNAWWQKLQTVSEYLWDPEKRMSLARTGLILVIYFFFY
ASLAAVITLCMYTLFLTISPYMPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVI
SLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGY
STGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYG
KLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgagaaggcagctccggtccagaagggctccggcctctccttacggttatcgctacaga
cttgacgatcaggatgaagtaaaccagaactacttggcagatgaagaggaagaagcggaa
gaagaggctcgggtgatggtggtacccgatttggaggaggaggaggaggaaaaggacgga
caggaggaggaagaggaggagatagaagaggaaaaggaggaggaagagggtcagggtccg
ccaacaggcaatgcctggtggcagaaattgcagaccgtaagcgaatacctgtgggatccg
gagaaaaggatgtctctggcccgaacaggcctgatcttagtcatttacttcttcttctat
gcctccctggctgctgtgattaccctctgcatgtacacgctatttctgaccatcagtcct
tacatgccgaccttcaccgagagggtgaagcctcctggagtgatgatcagacccttcgcc
catagccttaacttcaatttcaacgtttccgaacctgacacctggcagcattatgtcatt
agcctaaatggctttctccagggttacaatgacagtcttcaagaggaaatgaatgtggat
tgtcccccggggcagtacttcatccaagatggcgacgaggatgaagacaagaaggcctgc
cagtttaagcgctccttcctgaagaactgctcgggcttggaggaccctacttttggctac
tctactggacagccctgcatccttctaaagatgaaccggattgtaggcttccgtcctgaa
cttggagatcctgtgaaggtttcctgcaaagttcagagaggtgatgaaaatgacatccga
tccatcaattactacccagagtcggcttcttttgaccttcgctactacccttactacggc
aaactgactcacgttaactacacctccccactggtggccatgcactttacagacgtggtg
aagaaccaggcggtgcccgtgcagtgccaactgaagggcaagggcatcataaatgatgtc
atcaatgatcgttttgtggggagggtgatctttactctgaacatagaaacctaa

KEGG   Felis catus (domestic cat): 101096375
Entry
101096375         CDS       T02385                                 
Symbol
ATP1A4
Name
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101096375 (ATP1A4)
   04022 cGMP-PKG signaling pathway
    101096375 (ATP1A4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101096375 (ATP1A4)
   04918 Thyroid hormone synthesis
    101096375 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    101096375 (ATP1A4)
   04925 Aldosterone synthesis and secretion
    101096375 (ATP1A4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096375 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    101096375 (ATP1A4)
  09154 Digestive system
   04970 Salivary secretion
    101096375 (ATP1A4)
   04971 Gastric acid secretion
    101096375 (ATP1A4)
   04972 Pancreatic secretion
    101096375 (ATP1A4)
   04976 Bile secretion
    101096375 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    101096375 (ATP1A4)
   04974 Protein digestion and absorption
    101096375 (ATP1A4)
   04978 Mineral absorption
    101096375 (ATP1A4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101096375 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101096375 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    101096375 (ATP1A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101096375 (ATP1A4)
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     101096375 (ATP1A4)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101096375 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   101096375 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   101096375 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   101096375 (ATP1A4)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Ig_7
Other DBs
NCBI-GeneID: 101096375
NCBI-ProteinID: XP_023103614
Ensembl: ENSFCAG00000005405
LinkDB
Position
F1:complement(66789784..66818751)
AA seq 1074 aa
MGRQRKRGTVIPHEQILRPRHKRRHKSGKRRKMKRRTMKADMEELKKEAVMDDHKLTLEE
LSTKYSVDLTKGLSPKKAQEILNRDGPNVLTPPPTVSEWVKFCKQLFGGFSILLWMGAIL
CFVAYGIQMHFKEDLSRDNLYLGIVLSFVVVVTGCFSYYQEAKSSKIMESFKNMVPQQAL
VIRDGEKIQINVENVVVGDLVEVKGGDRIPADLRLISAQGCKVDNSSLTGESEPQSRSPD
FSHENPLETRNICFFSTNCVEGTARGVVIATGDSTVMGRIASLTSGLEMGKTPIAVEIER
FIHLITAVAVFLGVSFFGLSLSLGYGWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKR
MARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDETIYEADTSEEQTGKT
FAKGSATWFVLARIAGLCNRADFKANQETLPIVKRATTGDASESALLKFIEHSYSSVKEM
REKNPKVAEIPFNSTNKYQMSIHLQEESSQPHVLMMKGAPERILEFCSTYLLNGEEYPID
EKMKSKFQDAYLELGGLGERVLGFCFLNLPTTFSKGFKFDTDEINFPMEDLCFVGLITMI
DPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISGGDRTIDNVAAQLKVPV
CSSTDPREAKAIVVHGSDLKDMTSEQLDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAI
VAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDN
LKKSIAYTLTSNIPEITPFLLFIILSIPLPLGTITILCIDLGTDMVPAISLAYESAESDI
MKRAPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPLDLLGIRLNWE
NRFLNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSIFQQGMKN
NILIFGLMEETFLAVFLSYTPGMDMALRMYPLKPVRPCLGVFCFFVRRRALVTKTFYRDF
YREKKQTCHTTPLSSPCPPLRWSRACSSSSSATNSHTLLTFPSLAVFHTTLCGL
NT seq 3225 nt   +upstreamnt  +downstreamnt
atggggcgccagagaaaaagggggaccgtgatccctcacgagcagatcctaaggccaaga
cataaaaggaggcataaatcggggaagagaagaaaaatgaagaggagaacaatgaaggca
gacatggaggaactgaagaaggaagcggtcatggacgatcacaaattaaccctggaagag
ctgagcaccaagtactccgtggacctgacgaagggcctgagccccaaaaaggcacaggaa
atcttgaaccgagatggacccaacgtgcttacgccgccccccaccgtttcggaatgggtc
aagttctgtaaacaactctttggtggcttctccatcttactgtggatgggtgccattctc
tgcttcgtggcctatggcatccagatgcatttcaaggaggatctttccagagataatctg
tacctgggcatcgtactgtccttcgtggtcgtcgtcaccggctgcttctcctattaccag
gaggccaagagctccaagatcatggagtctttcaagaacatggtgcctcagcaagctttg
gtgattcgggatggagagaagatacagatcaacgtagagaacgtggtggtaggagacttg
gtggaggtgaagggcggagaccgaatccctgcggacctccggctcatctctgcacaagga
tgtaaggtggacaactcctccttgactggagagtcagagccccagtcccgctcccctgac
ttcagccacgagaaccctctggagactcgtaacatctgcttcttctccaccaactgcgtg
gaaggaacagcccggggcgttgtgatagcaacgggagactccacagtgatgggccgcatc
gcctccctgacgtcgggcctggagatgggcaagacccccatcgctgtggagatcgaacgc
ttcatccatctgatcacggcggtggccgtcttccttggcgtctcgttcttcgggctctcg
ctcagcttgggctacggctggctggaggctgtcatttttctcatcggcatcatcgtggcc
aatgtgcccgaggggctgctggccaccgtcactgtgtgtctgaccctgaccgccaagcgc
atggcgcgcaagaactgcctggttaagaacctggaggcggtggagacgctgggctccacc
tccaccatctgctcggacaagacggggaccctcacccagaaccgcatgaccgtcgcccac
atgtggttcgatgagaccatctacgaggcggacaccagcgaagagcagaccgggaaaacg
tttgccaagggctcagctacctggttcgtcctggcccgaatcgccggcctctgcaaccga
gctgactttaaggctaaccaggagacccttcccatcgtcaagcgagccacaacaggcgat
gcttctgagtcggccctcctcaagttcatcgagcattcgtacagctctgtgaaggagatg
agagagaaaaaccccaaggtggccgagattccctttaattccaccaacaagtaccagatg
tccatccacctgcaggaggagagctcccagccccacgtgctgatgatgaagggggccccc
gagaggatcctggagttttgctccacgtaccttctgaacggagaggagtaccccatagac
gagaagatgaagagcaagttccaggacgcctatctggagctgggaggcctgggggagcgc
gtgctcggcttctgtttcttgaatctgcccaccactttctccaagggattcaagtttgac
acagatgagatcaatttccccatggaggacctttgctttgtggggctcatcaccatgatt
gaccctccccgggccgccgtgcccgacgccgtgggcaagtgtcgcagtgcggggattaag
gtgattatggtaacaggggatcatcccattacagccaaggccatagccaaaggggtgggc
atcatctctggaggcgatagaacaatagacaacgtggctgcccagctcaaggtccccgtc
tgcagcagcaccgaccccagggaagccaaggccatcgtggtgcacggctcggacctgaag
gacatgacgtcggagcagctggacgagatcctcaggaaccacacggagatcgtgttcgcg
cggacgtccccgcaacagaaactcatcatcgtggagggctgtcagaggcagggggccatc
gtggcggtgacgggggacggcgtgaacgactcccccgcgctgaagaaggctgacatcggc
atcgccatgggcatctcgggctccgacgtgtcgaagcaggccgccgacatgatcctgctg
gacgacaacttcgcctccatcgtcacgggcgtggaggagggccgcctcatctttgacaac
ctgaagaaatccatcgcgtacaccctgaccagcaacatccccgagatcacccccttcctg
ctcttcatcatcctcagcatccccctgcctctgggcaccatcaccatcctctgcatcgac
ctgggcacagacatggtcccggccatctccttggcttacgagtcagctgaaagtgacatc
atgaagagggccccgcggaatccaaagactgataacctggtgaaccaccgtctcattggc
atggcctacggacagattgggatgatccaggctctggctggcttcttcacctacttcgtg
atcctggccgagaatggtttcagacctcttgatctgctgggcatccgtctcaactgggaa
aacagattcctcaatgacctggaggacagttacggacagcaatggacctacgagcagcgg
aaggtggtggagttcacgtgccacacggccttctttgtcagcatcgtggtcgtgcagtgg
gccgacctcatcatctgcaagacccgccgtaactccatcttccagcagggcatgaaaaac
aacatcctaatatttgggctcatggaggagacattcctggctgtttttctctcctacact
ccaggcatggacatggccctgcggatgtacccactcaagcccgtgcgtccgtgtcttggt
gtattttgtttttttgtacgtcggcgtgcgcttgttacgaagacgttctatcgcgacttt
tacagggaaaaaaagcaaacgtgccataccaccccactctcatcgccctgcccgcctctg
cgatggtctcgggcatgttcgtccagctcatctgccacgaattcacacactttgctcacc
tttccgtcccttgcagtgtttcacacaacgctttgtgggctgtag

KEGG   Felis catus (domestic cat): 101096785
Entry
101096785         CDS       T02385                                 
Name
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101096785
   04022 cGMP-PKG signaling pathway
    101096785
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101096785
   04918 Thyroid hormone synthesis
    101096785
   04919 Thyroid hormone signaling pathway
    101096785
   04925 Aldosterone synthesis and secretion
    101096785
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096785
   04261 Adrenergic signaling in cardiomyocytes
    101096785
  09154 Digestive system
   04970 Salivary secretion
    101096785
   04971 Gastric acid secretion
    101096785
   04972 Pancreatic secretion
    101096785
   04976 Bile secretion
    101096785
   04973 Carbohydrate digestion and absorption
    101096785
   04974 Protein digestion and absorption
    101096785
   04978 Mineral absorption
    101096785
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101096785
   04961 Endocrine and other factor-regulated calcium reabsorption
    101096785
   04964 Proximal tubule bicarbonate reclamation
    101096785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101096785
Enzymes [BR:fca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     101096785
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101096785
  Exosomal proteins of other body fluids (saliva and urine)
   101096785
  Exosomal proteins of colorectal cancer cells
   101096785
  Exosomal proteins of bladder cancer cells
   101096785
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 101096785
NCBI-ProteinID: XP_019677883
Ensembl: ENSFCAG00000005397
LinkDB
Position
F1:complement(66826222..66848954)
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKVQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggccgtggggccggccgtgagtactcgcccgcggccaccacggcggagaatggaggc
ggcaagaagaagcagaaagaaaaggagctggatgagttgaagaaggaggtggccatggac
gaccacaagctgtccttggatgagctgggccgcaaataccaagtggacctctccaagggc
ctcaccaaccagcgggcccaggacattctggctcgggacgggcccaacgccctcaccccg
cccccgaccacccctgagtgggtcaagttctgtcgccagctctttgggggcttctccatc
ctgctgtggatcggggccattctctgcttcctggcctacggcatccaggccgccatggag
gatgaaccatccaatgacaacctctacctgggtgtggtgctggcagccgtggtcatcgtc
accggctgcttctcctattaccaggaggccaagagctccaagatcatggattccttcaag
aacatggtgcctcagcaagccctggtggtgcgggaaggagagaaggtgcagatcaacgcg
gaggaggtggtggtgggagacctggtggaggtgaagggcggagaccgcgtgcccgcggac
ctccggatcatctcttctcacggctgcaaggtggataactcatctctaacaggcgagtcg
gagccccagacccgctcccccgagttcacccacgagaaccccctggagactcgtaatatc
tgtttcttctctaccaactgtgtggaaggcacggccaggggcatcgtgattgccacaggc
gaccggacagtgatgggccgcatagccacgctggcctcaggcctggaggtcgggcggacg
cccatcgccatggagatcgaacacttcatccagctgatcacgggggtggccgtgttcctg
ggggtctccttcttcgtgctctccctcatcctgggctacagctggctggaggcggtcatc
ttcctcatcggcatcatcgtggccaacgtgcccgaggggctgctggccactgtcaccgtg
tgtctgaccctgaccgccaagcgcatggcgcgcaagaactgcctggtgaagaacctggag
gcggtggagacgctgggctccacctccaccatctgctcggacaagacggggaccctcacc
cagaaccgcatgaccgtcgcccacatgtggttcgacaaccagatccatgaggccgacacc
accgaagatcagtccggggccacttttgacaagcgatcccccacgtggacggccctgtct
cggattgccggcctctgcaaccgcgctgtcttcaaggccgggcaggagaacatctctgtg
tcgaagcgggacacagccggcgacgcctccgagtcagctctgctcaagtgcatcgagctg
tcctgcggctccgtgaggaagatgagggatagaaaccccaaggtggcggagatccccttc
aattccaccaacaagtaccagctgtctatccacgagcgggaagacagcccccagagccac
gtgctggtgatgaagggagccccggagcgcatcctggaccggtgttccaccatcttggtg
cagggcaaggagatccctttggacaaggaaatgcaagatgcctttcagaacgcctacatg
gagctgggcgggctgggggagcgcgtgctggggttttgtcagctgaatctgccctctggg
aagttccctcgcggattcaaatttgacacagacgagctgaactttcccacggagaagctc
tgcttcgtggggctcatgtccatgatcgaccctccccgggctgccgtgccggacgccgtg
ggcaagtgtcgcagtgcgggcatcaaggtgatcatggtgactggggaccacccgatcaca
gccaaggccattgccaaaggtgtgggcattatatcagagggcaatgagactgtggaggac
atcgcagcccggctcaacattcctgtcagccaggtcaaccccagagaagccaaggcgtgc
gtcgtgcacggctcggacctgaaggacatgacgtcggagcagctggacgagatcctcagg
aaccacacggagatcgtgttcgcgcggacgtccccgcaacagaaactcatcatcgtggag
ggctgtcagaggcagggggccatcgtggcggtgacgggggacggcgtgaacgactccccc
gcgctgaagaaggctgacatcggcatcgccatgggcatctcgggctccgacgtgtcgaag
caggccgccgacatgatcctgctggacgacaacttcgcctccatcgtcacgggcgtggag
gagggccgcctcatctttgacaacctgaagaaatccatcgcgtacaccctgaccagcaac
atccccgagatcacccccttcctgctcttcatcatcgccaacatccccctgcctctgggc
accgtgaccatcctctgcatcgacctgggcacagacatggtcccggccatctccctggcc
tacgaggcggctgagagtgacatcatgaagcggcagcccaggaaccctcagacagacaag
ctggtgaacgagaggctcatcagcatggcctacggacagatcgggatgatccaggcactg
ggtggcttcttcacctacttcgtcatcctggcggagaacggtttcctgccatcacggctg
ctgggaatccgcctggactgggacgaccggtccatgaacgacctagaggacagctacgga
caggagtggacctacgagcagcggaaggtggtggagttcacatgccacacggccttcttt
gccagcatcgtggtcgtgcagtgggccgacctcatcatctgcaagacccgccgtaactcg
gtcttccagcagggcatgaagaacaagattctgatttttgggctcctggaggagacagcg
ctggcggccttcctgtcctactgcccgggcatgggtgtggccctccgcatgtacccactc
aaggtcacttggtggttctgtgccttcccctacagcctcctcatattcatctacgatgag
gtccgaaagctcatcctgcggcggtatcccggcggctgggtggagaaggagacgtactac
tga

KEGG   Felis catus (domestic cat): 101097586
Entry
101097586         CDS       T02385                                 
Symbol
ATP1B3
Name
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101097586 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    101097586 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101097586 (ATP1B3)
   04918 Thyroid hormone synthesis
    101097586 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    101097586 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    101097586 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101097586 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    101097586 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    101097586 (ATP1B3)
   04971 Gastric acid secretion
    101097586 (ATP1B3)
   04972 Pancreatic secretion
    101097586 (ATP1B3)
   04976 Bile secretion
    101097586 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    101097586 (ATP1B3)
   04974 Protein digestion and absorption
    101097586 (ATP1B3)
   04978 Mineral absorption
    101097586 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101097586 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101097586 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    101097586 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101097586 (ATP1B3)
CD molecules [BR:fca04090]
 Proteins
  101097586 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 101097586
NCBI-ProteinID: XP_023116277
Ensembl: ENSFCAG00000030431
LinkDB
Position
C2:complement(123975894..124022335)
AA seq 280 aa
MTKKEKKSFNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWA
MLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYSFSASDPESYQRYTEDLRNFLKPYDLE
EQKNLTACPDRVLFVQKGPIYHACQFPVALLEACSGVDDPEFGYSRGNPCILVKMNRIIG
LKPQGEPRIECISKSENTAALSTYPPNGAIDLKYFPYYGKKLHVSYLQPLVAVQVSFNAS
SSAVKEVTVECKIDGSPNLKNQDDRDKFLGRVVFKITARA
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacgaagaaagagaagaagtccttcaaccagagcctagccgagtggaagctcttcatc
tacaaccccaccaccggagagttcctggggcgcaccgccaagagctggggtttgatcttg
ctcttctacctagtcttttatgggttcctggctgcactcttctcatttacaatgtgggct
atgcttcagactctgaatgatgaggttccaaaataccgtgaccagattcctagtccagga
cttatggtttttccaaaaccagtaactgcattggaatattcattcagtgcgtctgatcca
gagtcctatcaaaggtacactgaagaccttaggaactttctaaaaccatatgatttagaa
gaacagaagaatctcacagcttgtcctgaccgagtgctttttgtacagaagggtccaatt
tatcatgcatgtcagtttcctgttgccttacttgaagcatgcagtggtgtggatgatcca
gagtttggctactccagaggaaatccttgtattcttgtgaaaatgaacagaataattgga
ttaaagcctcaaggagaaccaaggatagaatgtatttcaaagagtgaaaacacagcagct
ctatcaacttatcctcccaatggagctatagatttaaaatattttccatattatgggaaa
aaactccatgtgagttatctgcagccattagttgctgtccaggtgtcctttaatgctagc
agcagtgccgtaaaagaagtaacagtcgaatgcaagattgatggatcacccaacctaaaa
aaccaggatgatcgtgacaagtttttaggacgagttgtgttcaaaatcacagcacgtgca
tag

KEGG   Felis catus (domestic cat): 101100258
Entry
101100258         CDS       T02385                                 
Symbol
ATP1B2
Name
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2 isoform X3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04911  Insulin secretion
fca04918  Thyroid hormone synthesis
fca04919  Thyroid hormone signaling pathway
fca04925  Aldosterone synthesis and secretion
fca04960  Aldosterone-regulated sodium reabsorption
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca04964  Proximal tubule bicarbonate reclamation
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04973  Carbohydrate digestion and absorption
fca04974  Protein digestion and absorption
fca04976  Bile secretion
fca04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101100258 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    101100258 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101100258 (ATP1B2)
   04918 Thyroid hormone synthesis
    101100258 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    101100258 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    101100258 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101100258 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    101100258 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    101100258 (ATP1B2)
   04971 Gastric acid secretion
    101100258 (ATP1B2)
   04972 Pancreatic secretion
    101100258 (ATP1B2)
   04976 Bile secretion
    101100258 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    101100258 (ATP1B2)
   04974 Protein digestion and absorption
    101100258 (ATP1B2)
   04978 Mineral absorption
    101100258 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101100258 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101100258 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    101100258 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101100258 (ATP1B2)
CD molecules [BR:fca04090]
 Proteins
  101100258 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 101100258
NCBI-ProteinID: XP_003996234
Ensembl: ENSFCAG00000009622
UniProt: M3WBS4
LinkDB
Position
E1:2527651..2533896
AA seq 290 aa
MVIQKETKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLTTPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGHFVMFPANGSIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaggagacgaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagttcatgggccgcaccgggaccagctgggcctttatc
ctcctcttctacctcgtcttctatggcttcctcacggccatgttcaccctcaccatgtgg
gtcatgctgcagacggtctctgaccatacccccaagtaccaggaccgactgaccacaccg
ggcttgatgattcgccccaagactgagaatcttgatgtcattgtcaacgtcagtgacact
gaaagctgggaccaacatgttcagaagctcaacaagtttttggagccttacaacgattcc
atccaagcccagaagaatgacgtctgccgccctgggcgctattacgaacagccagacaac
ggagtcctcaactacccgaagcgtgcctgccagttcaaccggacccagctgggcgactgc
tctggcatcggggacccgacccactatggttacagcaccgggcagccctgtgtcttcatc
aagatgaaccgggtcatcaacttctacgcgggagcgaatcagagcatgaatgttacctgt
gtggggaagcgggacgaagatgctgagaacctcggccactttgtcatgttccctgccaac
ggcagcatcgacctcatgtacttcccttactatggcaaaaagttccacgtgaactacacg
cagcccctggtggccgtgaagttcctgaacgtgacccccaatgtggaggtgaacgtagaa
tgccggatcaatgccgccaacatcgccacagacgatgagcgggacaagttcgcgggccgc
gtggccttcaaactccgcatcaacaaaacctga

DBGET integrated database retrieval system