KEGG   Felis catus (domestic cat): 101081984
Entry
101081984         CDS       T02385                                 
Name
(RefSeq) microtubule-associated proteins 1A/1B light chain 3B
  KO
K10435  microtubule-associated protein 1 light chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04216  Ferroptosis
fca04371  Apelin signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101081984
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101081984
   04137 Mitophagy - animal
    101081984
  09143 Cell growth and death
   04216 Ferroptosis
    101081984
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101081984
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081984
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101081984
   05022 Pathways of neurodegeneration - multiple diseases
    101081984
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081984
   03029 Mitochondrial biogenesis [BR:fca03029]
    101081984
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101081984
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101081984
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    101081984
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     101081984
SSDB
Motif
Pfam: ATG8 APG12 Cytochrom_B559a APG5
Other DBs
NCBI-GeneID: 101081984
NCBI-ProteinID: XP_019687508
LinkDB
Position
B3:complement(20108073..20109876)
AA seq 124 aa
MLSEKTFKQRHTFEQRVDVRLIREQHPTKIPVITERYKGEKQLPVLDKTKFLVPDHVNMS
ELIKIIRRHLQLNANQEFFLLVNGHSMVSVSTPISEVYEREKDEDGFLHMVYASQETFGI
KVSV
NT seq 375 nt   +upstreamnt  +downstreamnt
atgctgtcggagaagaccttcaagcagcgccacacctttgaacaaagagtagatgtccga
cttatccgagagcagcatcctacaaaaatcccagtgatcacagaacgatacaagggtgag
aagcaacttcctgtactggacaaaaccaagttccttgtacctgatcacgtcaacatgagt
gagctcatcaagatcattaggaggcacttacagctcaatgctaatcaggagttcttcctg
ttagtcaatggacacagcatggtgagtgtgtccactccgatttctgaagtgtatgaacgt
gagaaggacgaagatgggttcctgcatatggtatatgcctctcaggagacatttggaatc
aaagtgtctgtgtaa

KEGG   Felis catus (domestic cat): 101085618
Entry
101085618         CDS       T02385                                 
Symbol
MAP1LC3A
Name
(RefSeq) microtubule-associated proteins 1A/1B light chain 3A
  KO
K10435  microtubule-associated protein 1 light chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04216  Ferroptosis
fca04371  Apelin signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101085618 (MAP1LC3A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101085618 (MAP1LC3A)
   04137 Mitophagy - animal
    101085618 (MAP1LC3A)
  09143 Cell growth and death
   04216 Ferroptosis
    101085618 (MAP1LC3A)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101085618 (MAP1LC3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101085618 (MAP1LC3A)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101085618 (MAP1LC3A)
   05022 Pathways of neurodegeneration - multiple diseases
    101085618 (MAP1LC3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101085618 (MAP1LC3A)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101085618 (MAP1LC3A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101085618 (MAP1LC3A)
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101085618 (MAP1LC3A)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    101085618 (MAP1LC3A)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     101085618 (MAP1LC3A)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 101085618
NCBI-ProteinID: XP_003983644
Ensembl: ENSFCAG00000022040
UniProt: M3XB56
LinkDB
Position
A3:complement(24805973..24807656)
AA seq 121 aa
MPSDRPFKQRRTFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDDDGFLYMVYASQETFG
F
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccctcagaccggcctttcaagcagcggcggaccttcgccgaccgctgtaaggaggtg
cagcagatccgcgaccagcaccccagcaagatcccggtgatcatcgagcgctacaagggt
gagaagcagctgccagtcctggacaagaccaagttcctggtgccagaccatgtcaacatg
agcgagttggtcaagatcatccggcgccgcctgcagctgaaccccacgcaggccttcttc
ctgctggtgaaccagcacagcatggtgagcgtgtctacgcccatcgccgacatctacgag
caggagaaggatgacgatggcttcctctacatggtctacgcctcccaggaaaccttcggc
ttctga

KEGG   Felis catus (domestic cat): 101094318
Entry
101094318         CDS       T02385                                 
Symbol
MAP1LC3C
Name
(RefSeq) microtubule-associated proteins 1A/1B light chain 3C
  KO
K10435  microtubule-associated protein 1 light chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04216  Ferroptosis
fca04371  Apelin signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101094318 (MAP1LC3C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101094318 (MAP1LC3C)
   04137 Mitophagy - animal
    101094318 (MAP1LC3C)
  09143 Cell growth and death
   04216 Ferroptosis
    101094318 (MAP1LC3C)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101094318 (MAP1LC3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094318 (MAP1LC3C)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101094318 (MAP1LC3C)
   05022 Pathways of neurodegeneration - multiple diseases
    101094318 (MAP1LC3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094318 (MAP1LC3C)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101094318 (MAP1LC3C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101094318 (MAP1LC3C)
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101094318 (MAP1LC3C)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    101094318 (MAP1LC3C)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     101094318 (MAP1LC3C)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 101094318
NCBI-ProteinID: XP_019677082
UniProt: A0A337S3R3
LinkDB
Position
F1:9713290..9719344
AA seq 141 aa
MQPPQKTQSLRPFKERKSLATRQEEVAGIRAKFPNKIPVIVERYPREKFLPPLDKTKFLV
PQELTMTQFLSIIRSRLVLGTSEAFYLLVNNKSLVSMSVTMAEVYRDYQDEDGFVYVTYA
SQEMFGCLGSGKTLPSSAEHV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgcagcctccacagaaaacccaaagcctcagacccttcaaggagaggaagagtttagca
accagacaagaggaagttgctggaatccgggcaaagttcccaaacaagatcccggtgata
gtggagcgctatcccagggaaaagttcctgcctccgctggacaagaccaagttcctggtc
cctcaagagctgaccatgacccagttcctcagcatcatccggagccgcctggtcctgggg
acttctgaagccttttacttgctggtgaacaataagagcctggtcagcatgagtgtgacc
atggcagaggtctacagggactaccaggatgaggacggcttcgtgtacgtgacctacgcc
tcccaggagatgttcggctgcctgggctccgggaagaccctgccgtcctctgcagagcat
gtctag

KEGG   Felis catus (domestic cat): 101095070
Entry
101095070         CDS       T02385                                 
Name
(RefSeq) microtubule-associated proteins 1A/1B light chain 3C-like
  KO
K10435  microtubule-associated protein 1 light chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04216  Ferroptosis
fca04371  Apelin signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101095070
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095070
   04137 Mitophagy - animal
    101095070
  09143 Cell growth and death
   04216 Ferroptosis
    101095070
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101095070
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095070
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101095070
   05022 Pathways of neurodegeneration - multiple diseases
    101095070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095070
   03029 Mitochondrial biogenesis [BR:fca03029]
    101095070
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095070
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101095070
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    101095070
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     101095070
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 101095070
NCBI-ProteinID: XP_003999185
LinkDB
Position
F1:complement(9803640..9807626)
AA seq 145 aa
MQPPQKTQSLRPFKQRKSLATRREEVARIQAKFPSKILTLNGVVVEHYPRERFLPPLDKT
RFLVLQALTMTLFPSVIRSRLVLGASEAFYLLVNNKSLVNMSVTMAEVYRDYQNEDGLMY
VTYASQEMFDCLGSRKTLPSSAEHV
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcagcctccacagaaaacccaaagcctcagacccttcaagcagaggaagagtttagca
accagaagagaggaagtcgctagaatccaggcgaagttccccagcaagatcctgactctt
aacggagtagtagtggagcactaccccagggagaggttcctgcccccgctggacaagact
cggttcctggtcctgcaggcactgaccatgaccctcttccccagtgtcatcaggagccgc
ctggtcctgggggcctctgaagccttttacttgctggtgaacaataagagcctggtcaac
atgagtgtgaccatggcagaggtctacagggactaccagaatgaggacggcctcatgtat
gtgacctacgcctcccaggagatgttcgactgcctgggctccaggaagaccctgccgtcc
tctgcagagcatgtctag

KEGG   Felis catus (domestic cat): 101095705
Entry
101095705         CDS       T02385                                 
Symbol
MAP1LC3B
Name
(RefSeq) microtubule-associated proteins 1A/1B light chain 3B
  KO
K10435  microtubule-associated protein 1 light chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04216  Ferroptosis
fca04371  Apelin signaling pathway
fca04621  NOD-like receptor signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101095705 (MAP1LC3B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095705 (MAP1LC3B)
   04137 Mitophagy - animal
    101095705 (MAP1LC3B)
  09143 Cell growth and death
   04216 Ferroptosis
    101095705 (MAP1LC3B)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101095705 (MAP1LC3B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095705 (MAP1LC3B)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101095705 (MAP1LC3B)
   05022 Pathways of neurodegeneration - multiple diseases
    101095705 (MAP1LC3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095705 (MAP1LC3B)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101095705 (MAP1LC3B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095705 (MAP1LC3B)
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101095705 (MAP1LC3B)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    101095705 (MAP1LC3B)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     101095705 (MAP1LC3B)
SSDB
Motif
Pfam: ATG8 APG12 Rad60-SLD
Other DBs
NCBI-GeneID: 101095705
NCBI-ProteinID: XP_023100883
Ensembl: ENSFCAG00000001938
LinkDB
Position
E2:61871055..61884235
AA seq 125 aa
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYEREKDEDGFLYMVYASQETFG
IKVSV
NT seq 378 nt   +upstreamnt  +downstreamnt
atgccgtcggagaagaccttcaagcagcgccgcaccttcgaacaaagagtagaagatgtc
cgacttatccgagagcagcatcctacgaaaatcccagtgatcatagaacgatacaagggt
gagaagcaacttcctgtactggacaaaaccaagttccttgtacctgatcacgtcaacatg
agtgagctcatcaagatcattaggaggcgcttacagctcaacgccaatcaggcgttcttc
ctgttagtcaatggacacagcatggtgagtgtgtccacgccgatttctgaagtgtatgaa
cgtgagaaggacgaagacgggttcctgtatatggtatatgcctctcaggagacatttgga
atcaaagtgtctgtgtaa

DBGET integrated database retrieval system