KEGG   Felis catus (domestic cat): 101082005
Entry
101082005         CDS       T02385                                 
Symbol
DYNC2H1
Name
(RefSeq) cytoplasmic dynein 2 heavy chain 1 isoform X1
  KO
K10414  dynein cytoplasmic 2 heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082005 (DYNC2H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101082005 (DYNC2H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101082005 (DYNC2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101082005 (DYNC2H1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:fca03037]
    101082005 (DYNC2H1)
   04812 Cytoskeleton proteins [BR:fca04812]
    101082005 (DYNC2H1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101082005 (DYNC2H1)
Cilium and associated proteins [BR:fca03037]
 Primary cilia and associated proteins
  Dynein and associated proteins
   101082005 (DYNC2H1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101082005 (DYNC2H1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_5 AAA_lid_11 Dynein_heavy DHC_N1 AAA_7 MT AAA_22 AAA_16 RsgA_GTPase AAA AAA_24 AAA_30 ABC_tran AAA_28 AAA_18 Laminin_I AAA_33 ATPase_2 AAA_29 PBC AAA_23 DUF4164
Other DBs
NCBI-GeneID: 101082005
NCBI-ProteinID: XP_023094816
Ensembl: ENSFCAG00000028573
LinkDB
Position
D1:1666781..2012430
AA seq 4347 aa
MAGGARDVRKAFLLTTTQNYFGLLPEPCDQPRADGCPEVNNFLDDGNQMLLRVQRSDAGV
TFSNSIDFADTKDKVLVFFKLRPEVITDQNLHSNILVSSMLESPINSLYQAVRQVFAPML
LKDQEWSRDLDPKLQNLLSELEAGLGVVLRRSDTNLSKLKFKEDDTRGILTPSDEFQFWV
EEAHRGSKQISRERAGYFKELFETIAREFYNLDSLSLLEVVDLVETTRDVVDDVWRQTEH
DHFPESRMLHLLDVIGGSFGRFVQKKLGTLNLWEDPYYLVKDHLRAGVSICEQWVIACNH
LTGQVWQRYVPHPWKSEKYFPETLDRLGKRLEEVLAVRTIHEKLLYFLPASEEKMICLTR
VFEPFTGLNPVHYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKIYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCRGVPGEASGPLAGKNLS
EVVNNIVWVRQLELKVDDTLKIAEALLSDLSGFRSFHRAAEDLLDQFKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEANSRIMELDPSDGSLKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGK
SQITWDNPKELEAYIQKLQNAAQRLATENRKLRKWHTTFCEKVVFLMNIDLLRQQQRWKD
GLQELRTGLASVEAQGFQAGDMRAWKQHWNHQLYKALEHQYQMGLEALNENLPEISIDLV
YKQGRLQFRPPLEEIRAKYYREMKRFIGIPNQFRGVGEAGEESIFSVMIDRNASGFLTIF
SKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLSTVQDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCNPVKTVIDDLIQKLFDTLVLSLKKCIQAHLHEIDAFVTEAMDVLTVMP
QSVEEIGDANLQYSRLQQRKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFEL
MMESHQLMIKDQIEVMKGNVQSRLQIYYQELEKFKARWDQLKPGDDIIETGPQSTLDKSA
KSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPSLSLADSISKDIESCAQIWALYEEFQQR
LEEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKTVIPILKYV
RGECLSPDHWLDLFRLLGLPRGTSLEKLMFGDLLRVADTIVAKASDLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFSRVDEDFRSIMS
DIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSTFPRFYFIGDDDLLEI
LGQSTSPSVIQSHLRKLFAGINSVCFDEESKHITAMKSLEGEVVPFKNKVLISNNVETWL
NGLAMEMKQTLKQLLAECVTAARSPPGVVDPSLFPSQILCLAEQIKFTEDVENAIQDHSL
HQIETQLVTKLEHYTSIDTSSEDPGGTESGILELKLKALILDIIHNIDVVKHLNQVQVHT
TEDWAWKKQVRFYMKSDHTCYIQMVDCELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKEAKVLGRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGGLLRQLQRAGGKHKVDESHIVVQALRLNTMSKFTFADCARFDA
LIKDVFPGIDFKEVEYDELRSALQHVFEEANYEIIPNQIKKALELYEQLRQRMGVVIVGP
SGAGKSTLWRMLRAALCRIGRVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDVNSLIKSWLKNQPPSYRNNLESWIGDYFEKALQWVLKQN
DYVVETSLVGTVMNGLSHLRGCKNHEQFVISLIRGLGGNLNMKSRLEFTKEVFTWARESP
PDPHKPMDTYYDSGRGRLASYVLKKPENLTADDFSNSQTLPVIQIPDMQRGLDYFKPWLS
SDTKQPFILVGPEGCGKGMLLRHAFSQLRSTQITTVHCSAQTTPRHLLQKLSQTCLVIST
NTGRVYRPKDCERLVLYLKDLNLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
HIVASMSAGGRLGRHKLTTRFTSIVRLCAVDYPEREQLQTIYGAYLEPVLYKNLKNHPIW
GSSSKIYLLAGSMVQVYEQVRARFTVDDYSHYLFTPCILTQWVLGLFRYDLEGGSSNHPI
DYVLEIVAYEARRLFRDKIVGAKELHLFDSILTSVFQGDWGSDILDNMADSFYVTWGARH
SSGARPTPGQPLPPHGKPLGKLSSADLKDVIKKGLIHYGRDNQMLDILLFQEVLEYVSRT
DRVLSCPGGSLLLAGRSGVGRRTVTSLVSHMHGAMLFSPKISRGYELKQFKNDIKHVLHL
AGVEAQQVVLLLEDYQLVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPVFNYFTYRIQQNLHIVLIMDCTNLNFIINCESNPALHKKCQVLWMEGWSDSSMRKIP
EMLFSETDGEEKYSDKKRKEEKKKHSVDPDFLKSFLLIHESCKAYGATPSRYMTFLRVYS
AISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQEIT
VSMQDASEQKTELERLKHKIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESL
SEIRSLRMPPDIIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVRDDIATFDARNIPKEIR
HSVEELLYKNKGSFDSKNAKRASTAAAPLAAWVKANIQYSHVLERIQPLETEQAALESNL
KKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSRAQETIKAAEVLINQLD
REHKRWNAQVAEITEELATLPKRAQLAAAFITYLSAAPEGLRKTCLEEWTKSACLEKFDL
RRFLCTESEQLIWKSEGLPSDDLSIENALVILQIIGLKSWSRVCPFLIDPSSRATEWLKT
HLKDSRLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEAVLYPLLRRDLVAQGPRYVI
QIGDKIIDYNEEFRLFLSTRNPNPFIPPDAAAIVTEVNFTTTRSGLRGQCVTILLSPHLA
NICLINCSHPSGPEMLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATS
QGNILENKDLIESLNQTKASSALTQESLKESYRLQISLDQERDAYLPLAESASKMFFIIS
DLAKINNMYRFSLAAFLRLFQRALHNKQFSNCNLQDSESTERRIQSLISSLKHMVYEYIC
RCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDTLRKADSQQRIREQLPSWIDQ
ERSWAVATLKITLPSLYQTLCLDDEALWRTYYHTSMCEQEFPSILAKKVSLFQQVLVVQA
LRPDRLQSAMGMFACKVLGLKELSPLPLNLKRLYKETLEIEPVLIIISPGADPSQELQEL
ANAERGGECYHQVAMGQGQADLAIQMLKECARSGDWLCLKNLHLVVSWLPVLEKELNTLQ
PKDTFRLWLTAEVHPHFTPILLQSSLKITYESPPGLKKNLMRTYESWTAEQISKKDSIHR
AHALFSFAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYSIIDRLFDGTKDVQWEFLHG
LLENAIYGGRIDNYFDLRVLQSYLKQFFNSSIIDVSNQRNKKSVFPYSISLPKSCSILDY
RALIEKLPEDDKPSFFGLPANIARSAQRMISSQVISQLRILGRSVTAGCKFDREIWSNEL
SPVLNLWKKLNQNSNLIHQKVCPPNDRQGSPVLSFIVLEQFNAIRLVQTVHQSLAALSKV
IRGTTLLSSEVQKLASALLNQKCPVAWQSRWEGPEDPLQYLRGLVARALAIQSWVERAEK
QALLSDTLDLSELFHPDTFLNALRQETARAMGCSVDSLKFVASWKGRLQEAKLQIKMGGL
LLEGCSFDGSRLAENQHDSPSVSPVLPCCVGWIPQGAYGPYSPDECISLPVYTSAERDRV
VTNIDVPCGGSPDRWIQCGAALFLKNQ
NT seq 13044 nt   +upstreamnt  +downstreamnt
atggcgggaggggcccgggacgttcggaaggccttcctcctcaccaccacccagaactac
ttcggcctcctgccggagccctgcgaccagccgcgggcggacggctgcccagaggtcaac
aactttctggacgacggcaaccagatgctcctcagggtgcagcgctcggacgccggcgtc
accttctccaactcgattgattttgctgacacaaaagataaagtgctggtgtttttcaag
ctgcgacctgaagtaattactgatcagaatctacatagtaacattcttgtttcgtctatg
ttagaatcacctataaattctctctatcaagccgtgcggcaagtatttgcaccaatgttg
ttaaaggatcaggaatggagcagagaccttgatcccaaacttcagaatcttttgagtgaa
ctagaagctgggttgggcgtagttctacgaagatcagacactaacttatcaaaattgaaa
tttaaggaagatgacacacgaggtattcttacaccaagtgatgagttccagttctgggtg
gaagaagctcatcgtggaagtaaacagattagcagagagagagccggctattttaaggag
ctgtttgaaaccatcgcaagagagttctataacttggacagtctatccttactggaagtg
gttgacttggtggagaccacccgggatgttgtagatgatgtatggagacaaacagagcat
gatcactttcctgagtcacggatgttacatctcttagatgtcataggtggttcatttgga
agatttgttcagaagaagttgggaactttgaatctgtgggaagatccttactatcttgtg
aaagaccacctcagagccggtgtgtccatttgtgaacagtgggtgatcgcctgtaaccac
ctcacgggtcaggtgtggcagcgctatgttcctcatccgtggaaaagtgagaaatacttc
cctgaaacactagacagactgggcaagcgcctggaagaggtcttggctgttagaacaatt
catgagaagcttctttattttttacctgccagtgaagagaaaatgatatgcctgactcga
gtatttgaaccctttaccggcctgaatcctgtgcattataatccatatactgagccttta
tggaaagctgcagtgtctcagtatgaaaaaattattgcacctgcggaacagaaaatagca
ggaaaattgaaaatttatatttcagaaattcaggacagcccacagcagcttcttcaagcg
tttctgaaatacaaagaactggtgaagcgtccaactataagtaaagaattgatgttagaa
agagaaactttgctggcaagacttgtggactcaataaaagattttcgattagactttgag
aatcgatgccgaggagttcctggtgaggcgtctggaccgcttgctggcaaaaacctgtcg
gaagttgttaataatatagtttgggttcgccagttggaactgaaggtggatgatactctc
aagattgcagaggctcttttatctgacttgtcaggatttcgatctttccatcgagctgcc
gaagatctgttagaccagtttaaactgtatgaacaagaacaatttgatgattggtccagg
gacattcagtccggtttgtctgattccagatccggcttgtgcatcgaggctaatagtcga
attatggaattggatcctagtgatggatcattaaaggtgcattattcagatcggttggtg
attctcctgagagaagttcgtcagctttctgctcttggctttgttattcctgccaaaata
cagcaagttgcaaacattgcacagaaattctgcaagcaagcaattattcttaaacaagtg
gcacatttttacaattccatcgatcaacaaatgattcaaagtcagagaccaatgatgtta
caatccgcattagcttttgaacagataattaagaattcaaaagcaggaagtgggggaaag
tcacagattacttgggataatcctaaagaattagaagcctacatccaaaagctccaaaat
gctgcccaacgacttgccactgaaaatagaaaactgagaaaatggcacactacattttgt
gaaaaggtcgtctttctcatgaacattgatctgcttcggcagcagcagcgttggaaagat
ggattacaagaactgagaactggcttagcaagcgtagaagcccaggggttccaggccggt
gacatgcgtgcgtggaagcagcactggaatcaccagctgtacaaagccctcgaacaccag
tatcagatgggcctggaggcacttaatgagaacctgccagaaataagcatagacctagtg
tacaaacagggacggttacaattcaggcctcctcttgaagaaatccgggctaaatattac
agagaaatgaagaggttcatcggcattcctaatcagtttaggggagtgggtgaggccgga
gaggagtctattttttctgttatgattgatagaaatgcaagtggatttttgactattttc
agcaaagcagaagatctgtttaggagactatcagctgttttacaccaacataaggaatgg
atcgtaattggacaagttgatatggaagctctagtggaaaaacatctctctacggtccaa
gattgggagaaaaatttcaaagcactgaaaataaaagggaaagaagtagaacgacttccg
agtgcagtcaaggtagattgtttaaatattaattgtaaccccgtgaagactgtgattgat
gatctcatccagaagttatttgatacacttgttctttctttgaagaagtgcatccaggct
cacttacatgaaattgatgcatttgtaaccgaggctatggacgtcttaacagttatgccc
cagtctgtggaagagattggtgatgcaaatttgcaatacagtaggctccaacagcggaaa
ccagagattttgcccttattccaagaagctgaagataaaaacagacttttacgaactgtg
gcaggtggaggtttggaaacaattagcaatctgaaggctaagtgggataaatttgagttg
atgatggaaagtcaccaacttatgattaaagatcagatcgaagtgatgaaagggaacgtt
cagtcgcgtcttcagatctattaccaagaattggaaaaatttaaagctcgttgggaccaa
ctaaagcctggtgacgatattattgaaactggcccacaaagtactcttgataaaagcgcc
aagtcaataaaagagaaaaagattgaatttgatgatcttgaagtcataaggaaaaagctg
gttgatgattgccatcattttggcctagaggagcccagcttgtctttggcagatagcatc
tccaaggacattgagagctgtgcacaaatttgggccctttatgaagagtttcagcagagg
cttgaggaaatggccaatgaagattggattacttttcggactaagacatatctgtttgaa
gaatttttgatgaattggcatgacagattaagaaaagttgaagaacattcagttatgacg
gtgaaattacaatcagaagttgacaaatacaaaaccgtaattcctatcttgaaatacgtg
agaggggagtgtctttctccagatcactggcttgacctttttcgtctgcttggccttcct
cgggggactagcctggagaaattaatgtttggtgacctgctcagagtagctgatacaatt
gttgccaaagcttcagaccttaaagatttaaacagtcgggcacaaggtgaagttacgatc
agagaagctttacgtgaacttgatctttggggagttggagcggtatttacattgattgat
tatgaagacagccagagtcgaactatcaagctgattaaagactggaaagacatcgtaaat
caagttggagataatagatgtcttcttcagtccttaaaggattctccttattataaggga
tttgaagataaagtgtccatttgggaaagaaaacttgcagaattagatgaatacctgcag
aatttaaaccatattcagaggaagtgggtgtatttggagcccatatttggccgtggagca
ttgccgaaagagcagacacgcttcagcagggttgatgaagattttcgatcgataatgagt
gacatcaagaaagacaatagagtcacaacattaacgactcacgcaggaatcagaaattcg
ctgctaaccatacttgatcaacttcaaagatgtcagaaatcattgaatgaatttttagag
gaaaaacgctcaacgtttccaaggttttatttcatcggtgacgatgacctgttggagatc
ctgggccagtctactagcccgtcagtgattcagtctcacctcagaaagctgttcgccggt
attaacagcgtgtgctttgatgaagaatcaaaacatataactgcaatgaaatctttagag
ggagaagttgtaccttttaaaaataaagttttaatttcaaataatgtagagacctggtta
aatggtttagccatggaaatgaagcagaccttgaaacagttgttggcggaatgtgtcact
gccgcacgcagtcctccaggtgtcgtggacccgtccttgttcccctcacagatactgtgt
ttggccgagcagattaagttcactgaagatgtggaaaatgctatccaagaccatagtctt
catcagattgaaacccagctggtgactaagttagagcactatactagcattgatacgagt
tcggaggatccagggggcactgagtctggcattctggagcttaaacttaaagccctgatt
cttgatatcattcataacattgatgtggtaaagcatttaaaccaagttcaggttcataca
actgaagactgggcctggaaaaaacaagtcagattttatatgaaaagtgatcatacttgt
tatattcaaatggtggattgtgaacttcagtacacttatgagtaccagggcaatgctccc
aagctggtctacacgccgctgacggacaagtgctacctgacgctgacgcaggccatgaag
atgggcctgggcgggaacccgtacgggccggcgggcacggggaagaccgagtcggtgaag
gccctgggcggacttctcgggagacaagtcttagtttttaattgtgatgagggcatcgat
gtgaagtcaatgggacggatttttgttggtttggtgaagtgtggggcctggggttgtttt
gatgagttcaatagactggaggagtctgtgctgtcggcagtgtccatgcaaatccagacc
atccaggatgccctgaagaaccacagaaccgtgtgcgagctgcttggcaaggaggtggaa
atcaattcaaattctgggatttttatcaccatgaatcctgctggaaaaggttacggagga
agacagaagctgcctgataatcttaaacagcttttcaggccggttgccatgtcccgccca
gacaacgagcttatcgctgaagtcattctctattcggagggcttcaaagaggccaaagtc
ctgggcagaaaactggtagctatcttcaatctatccagggaacttttgacacctcagcag
cattacgactggggtctgagagccttgaagacggttcttcgaggaagcggaggccttctt
agacagctgcagagagccggcgggaaacacaaagttgatgaaagtcatattgtggtacaa
gcattgaggcttaatacaatgtcaaagtttacatttgctgattgtgcacggtttgatgca
ctgattaaagatgtatttcctgggatcgactttaaagaagtagaatatgatgagctcagg
tctgcgttacagcatgtcttcgaggaagccaattatgaaatcataccaaatcagatcaag
aaggctttagaattgtatgagcagttacgccagaggatgggagtggtcattgttggtcca
agtggtgctggaaagtcaaccctttggaggatgttaagggcagcactttgtagaattggc
agagtggtgaaacagtacaccatgaaccccaaagccatgcctagacatcagctgttaggc
cacattgacatggacacacgggaatggtcggacggcgttttgacaaacagcgctcgccaa
gtcgttcgggaacctcaagatgtcagctcatggataatatgtgacggcgatattgaccct
gaatggatagaatctctgaattctgttctggatgacaatcgactcctcactatgcccagt
ggagaaaggattcagttcggcccaaatgttaactttgtgtttgaaactcatgatttaagt
tgtgcctcgccagccacaatatctagaatgggcatgatctttcttagcgatgaagagaca
gacgttaattctctgataaaatcttggttgaagaatcagcctcctagttataggaataat
cttgagagctggattggagattactttgaaaaggctttacagtgggttctgaagcagaat
gactatgtggttgaaaccagtttggttgggactgtgatgaatggtttgtcacatcttcgt
ggatgcaaaaatcatgagcagtttgttattagtctcatacgggggcttggtggaaacctg
aacatgaaatcccgcctggagttcaccaaagaggtttttacttgggcacgagagtctcct
ccagaccctcacaaaccaatggatacctactatgactcaggtcgggggcgactagcgtct
tatgtgctgaagaagccggaaaacttgaccgccgatgatttcagcaacagccaaactctc
cccgtcattcagattcctgacatgcagcgaggcctggattatttcaaaccctggttaagt
tcagatactaaacaaccatttattcttgtaggaccagaaggatgtggcaaagggatgctg
ctgagacatgccttttcccagctccggtccactcagatcaccacggttcactgtagcgcg
cagaccacgcctcgacacctcctgcagaagctgagccagacttgcctggtgatcagtacc
aacaccggtcgagtgtacagaccgaaagactgcgaaagacttgttttgtacttgaaagat
ctcaacctgcccaagctggataagtgggggaccagtactttggttgctttcctacaacag
gtattgacatatcaaggattttatgatgaaaatttggaatgggttggtttagaaaatatt
cacattgtggcttccatgtcagctggaggaagactgggaagacataagcttaccacccga
tttacttctattgtccgtctctgtgctgtggattacccagaaagagagcaattacagaca
atctatggagcatatttggaaccagttctatataaaaatctgaagaatcatcctatttgg
ggttcttcatcaaaaatctatctcttagcagggtctatggtacaagtgtatgaacaggta
cgggccagatttacagttgatgattatagtcactatttgtttactccgtgcatccttacc
cagtgggttcttggcttattcagatacgatttagaaggagggtcctcaaaccatccaata
gattatgtgttagaaattgtagcgtatgaagcacggcgcttatttcgtgacaaaattgtt
ggtgcaaaggaacttcatttatttgacagcattttaacatcagtgtttcaaggagattgg
ggctcagatatattagataatatggcagacagtttctatgttacgtggggagcccgacac
agttcaggagcaaggccaacccctgggcagcccctgcctccacacggaaaaccgcttggg
aaactgagctctgcagatcttaaggatgttattaagaagggccttattcattatggacga
gataaccagatgttagatattttacttttccaagaagtcctggagtatgtgtccaggaca
gacagagtgctgagctgccccgggggctccctgctgctggcgggacgcagcggggtaggc
cgccgcactgtcacgtccttagtgagccacatgcacggggccatgctgttttctccgaag
atctccagagggtatgaactgaagcagttcaaaaatgatatcaaacatgtgctgcatctt
gccggtgtggaagctcagcaggtggttttacttcttgaggactaccagttagtccatccc
acctttctggagatgatcaacagcctcttgtcttcaggtgaagttcctggactttatacc
cttgaagaattagagcctttgctgttgcctcttaaagatcaggcttcacaggatggtttt
tttggaccagtcttcaattacttcacatacagaattcagcaaaacttgcatattgttttg
ataatggattgtacgaatttaaacttcataataaactgtgagagtaacccagccttgcat
aaaaaatgccaggtgttgtggatggagggctggtcagacagcagtatgagaaaaatacct
gaaatgttattcagtgaaacagatggtgaagaaaaatatagtgacaaaaaaaggaaagaa
gaaaagaaaaaacactcagttgatcccgattttctaaaatcatttttattaatccatgaa
tcttgtaaagcatatggtgctacaccaagccgatacatgaccttcttacgtgtgtattct
gccattagtagcagcaagaaaaaggaattattaaaaagacaaagtcatttgcaggctggt
gtgtctaaactgaatgaagctaaagctcttgtggatgagctgaacagaaaagctggcgag
caaagtgtgttattaaagacgaagcaagacgaagcagacgccgcccttcaggagatcact
gtgtcgatgcaggatgctagtgagcaaaagacagaacttgaaagactgaagcacaagata
gcagaagaagttgttaaaattgaagaaagaaaaaacaaaattgatgatgagttaaaagaa
gtacagcctctagtcaatgaagctaaactagcagttggaaacatcaagccagaatctctt
tcagaaattcgctcactgcgcatgccacctgacatcatcagagacattcttgagggtgtt
ttaaggctgatggggatctttgatacatcttgggtgagcatgaaaagtttccttgcgaaa
agaggtgtgagagacgacatagcaacatttgacgcacgaaatattccaaaggagataaga
cacagtgttgaagaacttctttataaaaataaaggatcttttgattcaaagaacgcaaag
cgagccagtactgcggcggctcctttggccgcgtgggttaaagcgaacatccagtattcc
cacgtcttggaacggatccagcctttggaaactgaacaggcagcattagaatcaaatttg
aagaaaactgaagaccgaaaaaggaagctagaggaacttctaaattctgttggccagaaa
gtatcagaactcaaagagaaatttcagagcaggacttcagaagccgccaagctggaagct
gaagtgagcagagcgcaggaaacaattaaagccgcagaagtgctaattaatcagcttgac
cgagagcacaaaagatggaacgcacaggttgcagagataacagaggaattagctactctt
cctaagagggctcagctggctgccgccttcattacctatctttctgctgctcctgagggt
ctgagaaaaacctgcttggaagaatggaccaagtcagcttgtcttgaaaaatttgatcta
aggagatttctttgtactgaaagtgagcagttaatttggaaaagtgaaggcctaccatca
gatgacctttccatagaaaacgctcttgttatcttacagatcattggtttgaaatcatgg
agtcgagtatgcccattccttatagacccttcttctcgagctacagagtggttgaagaca
catttgaaagactcaagattggaagttattaaccagcaggatagtaactttatcacagct
ctcgagctggcagtgcggtttgggaaaacccttattatacaggagatggacggtgtagaa
gctgttctctatccgttattgagacgagatctggtcgctcaagggccacgttacgtgata
caaataggtgacaaaattatcgactacaatgaagaattccgccttttcttgtcaacaaga
aaccccaaccccttcatcccgccggacgcggccgccatcgttacggaggttaacttcacc
accacgagaagtggattgcgaggccagtgtgtgacgattctcctttctccccatctggcc
aacatctgtcttattaactgtagccatcctagtggacctgaaatgcttttggctttaact
attcagcatgagaaacctgacctagaggaacagaaaacaaaactgttacaacaggaagaa
gataagaaaatacagttagccaagcttgaggaatctcttttagagactcttgccacatct
caagggaatattttggaaaataaagatttgattgaatctctgaatcagacgaaagcaagc
agtgcacttactcaagagtcacttaaagaatcttacagactccagatttctcttgaccaa
gagcgggatgcgtaccttcccctcgctgagagcgccagcaagatgttcttcatcatctcc
gacttggccaaaattaacaacatgtaccgtttcagtttggctgcatttctccgactattc
cagcgggctctgcacaacaaacagttttcaaattgtaatctacaggattccgaaagtaca
gaacggagaatccagtctcttatcagctcattaaaacatatggtctatgaatatatatgc
cgttgtctgtttaaggctgaccagttgatgttcgcgctgcacttcgttcggggcatgcat
ccggaactttttcaagaaaatgaatgggatacgtttacaggtgtggttgttggagacacg
ttgcggaaagctgactctcagcagcgaatccgcgagcagctcccgtcgtggatagaccag
gagaggagctgggccgtagcaacactaaagattactctccctagtctttatcagaccctc
tgccttgacgatgaagcgctgtggcgtacttactatcacacttcaatgtgtgagcaagag
tttccgtctattcttgcaaagaaagtttccttatttcagcaggttctcgtggtgcaggcg
ctcagaccagacagactgcaaagtgccatgggcatgtttgcctgcaaagttctgggactg
aaagagctgtccccgctccctctaaatctcaaacgcctctacaaagagacactggagatt
gagcccgtcttgataatcatctccccgggtgcagatccttcccaggagctgcaggagctg
gctaatgctgagcgcggaggagagtgctaccaccaggttgctatgggtcagggtcaagcc
gatttagcgattcagatgctgaaggaatgtgcccgcagtggggactggctgtgtttgaag
aacttacatcttgtggtgtcttggctgccagttctggaaaaggaattaaatactcttcaa
cctaaagatacctttcgtctgtggctgactgcagaagttcatccccactttactcctatt
ttattacagtcaagtttaaagatcacatacgagtcacctccaggtttgaagaagaattta
atgcgcacttacgaatcttggactgctgagcaaatcagcaaaaaagacagcatccatcga
gctcacgctctctttagttttgcgtggtttcatgctgcatgtcaggaaagacgaaattac
attccacagggttggaccaagttttatgagttttctttatcagatcttcgggctggatac
agcattattgacaggctctttgatggtaccaaagatgttcagtgggaatttttacacggt
ttacttgaaaatgctatttatggcggacgcatagataactattttgaccttagagttctt
cagtcatacctgaaacagttttttaattcttcaataattgatgtttcaaaccaaaggaac
aagaaaagtgtttttccatattccatatctctccccaaatcctgcagcattctggactac
cgtgctctcatcgaaaagcttccggaggacgacaagcctagtttcttcggtcttcctgcc
aacattgctcgctcggcccagcgcatgatcagttctcaggttatttcacagttgaggatc
ttgggcagatcagtaacagctggttgcaaatttgatagagaaatctggtctaacgaactg
tcccctgtcctcaatctctggaagaaactaaaccagaactccaacctgattcatcagaag
gtgtgtcctcctaacgatcgacaagggtctccagtactgtccttcatcgtcctggaacag
ttcaatgccattcgcttagtgcagaccgtccaccagtctcttgccgctctcagcaaagtc
atcagagggaccaccttactgagttcagaagtacagaaactggccagcgctttactaaac
caaaagtgtcctgtggcatggcagagcaggtgggaaggcccagaagaccccttacagtac
ctgagaggcctcgtggctcgtgcccttgcgatacagagctgggtagagagagccgagaaa
caggctcttctctctgatacacttgacctgtcagaactgttccacccagacacgtttctc
aacgctcttcgccaggaaactgcacgggcgatgggctgttctgtagatagcctgaaattt
gtagcttcgtggaaaggccgactgcaagaagcaaagctgcagattaagatgggcggcttg
ctgctggaaggctgcagctttgatgggagccggctcgctgagaaccagcacgactctccc
agcgtgtcgcccgtcctcccttgctgtgtgggctggatcccccagggtgcatacggtccc
tattcccctgatgagtgcatatctttgcctgtttacacgagtgctgagagggatcgtgtg
gtgaccaacattgacgttccgtgtgggggcagcccggaccggtggattcagtgtggagct
gctttgtttctaaaaaatcagtag

KEGG   Felis catus (domestic cat): 101082576
Entry
101082576         CDS       T02385                                 
Symbol
DYNC1H1
Name
(RefSeq) cytoplasmic dynein 1 heavy chain 1
  KO
K10413  dynein cytoplasmic 1 heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101082576 (DYNC1H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101082576 (DYNC1H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101082576 (DYNC1H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101082576 (DYNC1H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101082576 (DYNC1H1)
   04147 Exosome [BR:fca04147]
    101082576 (DYNC1H1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101082576 (DYNC1H1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101082576 (DYNC1H1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101082576 (DYNC1H1)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT Dynein_heavy AAA_5 Dynein_AAA_lid AAA AAA_22 AAA_33 AAA_18 Mg_chelatase T2SSE AAA_19 AAA_lid_1 AAA_25
Other DBs
NCBI-GeneID: 101082576
NCBI-ProteinID: XP_023111814
Ensembl: ENSFCAG00000008938
LinkDB
Position
B3:146367568..146447245
AA seq 4646 aa
MSEPGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAALEEKS
ALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSLAFIK
RTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAP
SVEKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKVEDPT
FLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPEVLLT
LDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAI
FTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVF
QTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVI
VRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSK
EGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGA
IREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLSA
YMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTI
ESTRVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAIS
LIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGIALVWESYKLDPYVQRLAETV
FNFQEKVDDLLIIEEKIDLEVRSLETCMYDHRTFSEILNRVQKAVDDLNLHSYSNLPIWV
NKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVH
ELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQRYQVGVHYELTEEEKFYR
NALTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLNKWQ
ALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGSNMT
EFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRLLEKQ
RFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTD
WEKTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQ
VALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLRQY
ASYEFVQRLLKGYLKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQ
KNEAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVKEH
INSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIKHL
LPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLE
RERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGISSRE
GEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPNTYIT
WIDKYQAQLVVLSAQIAWSENVETALSSIGGSGDAAPLHSVLSNVEVTLNVLADSVLMEQ
PPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQ
MANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKALG
HQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQCIQE
ALREHSNPNCDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLFRSLA
MTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSA
GNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPLLFSL
LSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQINHGL
MMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWTDGLF
THVLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVR
IMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKG
KEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLGSLFS
MLHQACRNVAQYNANHPDFPMQIEQLERYVQRYLVYAILWSLSGDSRLKMRAELGEYIRR
ITTVPLPAAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVRHEAL
LYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCE
YRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTW
VKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLRLIP
SLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLPVEG
LIRIWAHEALRLFQDRLVEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSNWLSKD
YIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSG
AGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDESNVL
DSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIR
NLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEKPNY
IVPDYMPLVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFI
NHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKL
KKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAVKSIK
KQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEIS
DAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLE
DDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLK
SLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQAN
IQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFI
MNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRV
LITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAE
RPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEV
TRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLYQYSLQFFLDIYHNVL
YENPNLKGITDHTQRLSIITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTIGEPT
YDAEFQHFLRGKEIVLSAGSTPKIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIW
LDSSSPEQTVPYLWSEEAPSTPIGHAIHRLLLIQAFRPDRLLAMAHMFVSTNLGESFMSI
MEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEGFNQA
DKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLR
AGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFHAIIQERLRYAPLG
WSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRVDNEF
DQRLLNTFLERLFTTKSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSW
LGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKARTDSTSDGRPAWMRTL
HTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEG
KKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVADFSERIKQLQNISLAAASGG
AKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQSATLDACSFGV
TGLKLQGATCNNNKLSLSHAISTVLPLTQLRWLKQTNAERKANVVTLPVYLNFTRADLIF
TVDFEIATKEDPRSFYERGVAVLCTE
NT seq 13941 nt   +upstreamnt  +downstreamnt
atgtcagagccgggcggcggcggcggcgaggacggctcggccggcctggaggtgtcggcc
gtgcagaacgtggccgacgtgtcggtgctgcagaagcacctgcgcaagctggtgcctctg
ctgctggaggatggcggcgaggcgccggccgcgctcgaggcggcgctggaggagaagagc
gccctggagcagatgcgcaagttcctgtccgacccgcaggtccacacggtcctggtggag
cgctccacgctcaaagaggatgttggtgatgaaggcgaagaagaaaaagaattcatttcc
tataatatcaacatagacattcattatggagttaagtccaatagcttggcattcattaaa
cgcactccagtaattgatgcagacaaaccagtgtcttctcagcttcgggtcctcacactc
agtgaagactcaccgtatgaaaccttgcattctttcattagcaatgcggtggctcctttc
tttaagtcctatatcagagagtctggcaaggcagacagggatggtgataaaatggctccc
tcagttgaaaaaaagattgcagaacttgaaatggggctccttcacttgcagcagaatatt
gaaattccagagatcagcctgccaattcatcccattattacaaatgttgcaaaacagtgt
tacgaacgtggagaaaagccaaaagttacagactttggagataaggtcgaagacccaact
tttctcaatcaattacaatcaggagttaaccgctggatccgagaaattcagaaagtgacc
aaactggatagagaccctgcctcaggaacagccttgcaggaaatcagtttttggttgaac
ttggaacgagcactgtaccgcatacaggagaaacgagagagcccagaagtcctacttact
ctggatatcttgaaacatggcaagcgtttccatgccactgtcagttttgacactgacaca
ggtctaaaacaggctttggagactgtgaatgactataaccccctgatgaaggattttcct
ctgaacgacttactgtccgccactgagctggacaaaataaggcaggctctcgttgccatc
ttcacccatctgaggaagatccgaaacacaaaataccccattcagagggcgctgcgtttg
gtggaagcgatttcaagagacttgagttctcagttactcaaagtattgggcaccagaaaa
ttgatgcatgttgcttatgaggaatttgaaaaagttatggtcgcatgctttgaagtcttt
cagacttgggatgatgaatacgagaagcttcaggtgttactgagagacatcgtcaaaagg
aaaagggaggaaaatctaaagatggtgtggcgaatcaaccctgcccacaggaagcttcag
gcccgccttgaccagatgaggaaatttcgacggcagcatgaacagctgagagctgtcatt
gtcagggtcctgaggccacaggtcacggcagtcgcgcagcagaaccaaggagaagtcccc
gagcctcaggacatgaaagtggcggaggttctctttgatgccgcagacgcgaatgctatt
gaggaggtcaacctcgcgtacgagaacgtcaaggaagtggacgggctagacgtctccaag
gaaggcacggaagcttgggaggccgccatgaagagatatgatgagcggatcgacagggtg
gagacccggatcaccgctcgccttagggatcagcttggcacagccaagaacgctaacgag
atgttcaggattttctccaggttcaacgcgctgttcgtcaggcctcacatccgtggggcc
atccgcgagtaccagacccagctaatccagcgcgtgaaagacgacattgagtctctccac
gacaagttcaaggtccagtacccacagagtcaggcgtgtaagatgagccatgtgcgcgac
ctgcccccggtgtcgggctccatcatctgggcgaagcagatcgatcgccagctgagcgcc
tacatgaagcgcgtggaggacgtgctgggcaagggctgggagaaccacgtggagggccag
aagctgaagcaggatggggacagcttccgcatgaagctcaacactcaggagatcttcgac
gactgggcccggaaggtgcagcagcgcaacctgggcgtctcggggcgcatcttcaccatc
gaaagcacccgggtccgcggccgaactggaaacgtccttaagctgaaagttaacttcctt
cctgagatcatcacgctttcaaaggaagttcgaaatctcaagtggcttggtttccgagtc
ccgctggcgattgtgaacaaggcccatcaagcaaaccagctgtacccatttgccatctcg
ctgatcgagagcgtccgcacctacgagcggacctgtgagaaggtggaggagcgcaacacc
atttcccttctggtggccggcttgaagaaggaggtgcaggctctgatcgcagagggcatc
gcgctggtgtgggaatcctacaagctcgacccctacgtgcagcgcttggcggagaccgtc
ttcaacttccaggaaaaggtggatgatctgctaataatagaagaaaaaatcgacctggaa
gtccgttccctggagacttgcatgtatgatcacaggactttctcagagatcttgaacaga
gttcagaaagccgtggacgacttaaacctgcactcctattccaacttgcccatctgggtc
aataagcttgacatggagattgaaagaatactgggcgttcgcctacaagctggcctgaga
gcttggacccaggtgcttcttggacaagctgaagataaagcagaagttgacatggataca
gacgcaccacaagttagtcacaagcctggtggggagccaaagattaaaaatgtcgttcat
gagctaaggataaccaatcaggtcatctatttgaacccgcccatcgaagagtgcaggtac
aagctgtaccaggaaatgtttgcctggaagatggttgtgctgtctctgcccaggatccag
agtcagaggtaccaggtgggtgttcactacgaattgactgaagaagagaaattctaccgg
aatgctttaacgcggatgcctgatggccccgttgccctggaagagtcctactctgcggtc
atgggcatcgtgactgaggtcgagcagtacgtcaaggtctggcttcagtaccagtgcctg
tgggacatgcaagccgaaaacatctacaacagactcggagaagatctcaacaaatggcag
gctctcctggtgcaaatacggaaggcccgaggaacttttgacaatgcggaaaccaagaag
gagtttgggccagtcgtcatagattacggcaaggtgcagtccaaggtgaacttgaagtac
gactcttggcataaggaggttctcagcaaatttggacagatgctcgggtcaaacatgaca
gaattccattcccagatctcgaagtcacggcaggagttggagcagcactcggtggacacg
gccagcacctcggatgcggtgaccttcatcacctacgtgcagtctctgaaacgaaagata
aaacagtttgagaaacaagttgagctctaccgcaatggccagcgcctgctggagaagcag
aggttccagttcccgccctcctggctctacatcgacaacatagagggtgagtggggggcc
ttcaacgacatcatgcggcggaaggactctgccattcagcagcaggtggcaaacctgcag
atgaagatcgtgcaggaggaccgggccgtggagagccgcaccaccgacctgctgacggac
tgggagaagaccaagcctgtcacgggcaatctccgcccagaggaggcgcttcaggctctt
accatatacgaaggaaagttcggcaggctgaaggacgaccgggagaagtgtgcgaaggcc
aaggaggcgctggagttgaccgacacggggctgctcagcggcagtgaagagcgcgtccag
gtggccttagaagaactgcaggacctcaaaggcgtttggtcggaactttccaaggtctgg
gagcagattgatcagatgaaggagcagccgtgggtttccgtccagcctcgaaagcttcga
caaaatttagatggcctcctgaaccagctgaaaaacttccctgcccgattacggcagtac
gcatcctatgagtttgtccagaggcttctgaaaggctacctgaagataaacatgctggtg
attgaactgaagtccgaagccctcaaagaccgccattggaagcagctgatgaaaagactt
cacgtcaactgggttgtttctgagctaaccctgggccaaatctgggatgttgacttgcag
aaaaatgaagctattgtcaaggatgtgctgcttgtggcacaaggggagatggctttggaa
gaatttttgaagcagataagagaagtatggaatacttacgagttagacttggttaactac
cagaacaagtgtcgcttgatccgaggttgggatgacctcttcaacaaggtcaaagagcac
atcaacagtgtctccgccatgaagctctctccgtactacaaggttttcgaagaggatgcc
ctgagctgggaagataagctgaatcggatcatggctctctttgacgtgtggattgacgtg
cagaggcggtgggtgtacctggaaggcatcttcacgggcagcgcggatatcaagcacctg
ctgccggtggagacccagcggttccagagtatcagcacggagtttttggctctgatgaaa
aaggtatccaagtctccccttgtaatggatgttctgaatatccagggggtacagaggtct
ctggagagactggcagacctgctaggaaagatccagaaagcattgggagaatacctggaa
agagagcgatcctctttccccaggttctattttgtgggtgatgaagatttgcttgaaatc
attggaaacagtaagaatgtagctaagttacagaaacatttcaagaaaatgtttgctggc
gtttcgagcatcatcctaaacgaggataactctgtcgtcttgggcatttcctcccgtgaa
ggagaggaggtcatgtttaaaactcctgtgtcgattactgaacatcccaaaatcaacgag
tggctcacgctggtagaaaaggagatgagagtcacactggctaaacttctggctgagtct
gttacagaagttgagatttttggtaaagcaacttcgattgacccaaatacctacatcact
tggattgataagtaccaggcccagcttgtggttttgtcagcccagatagcctggtctgaa
aacgtggagacggctctgagcagcatcggcggaagcggtgacgcggcacccttgcactcc
gtgctgagcaacgtggaggtcaccctcaacgtgttggccgactcggtcctcatggagcag
ccaccgctgcggaggcggaagctggagcacttgattacagagttggttcaccagagggac
gttacacgctccttgatcaaaagcaagattgacaatgccaaatctttcgaatggctcagc
cagatgcgcttttacttcgaccctaagcaaaccgatgtgctacagcagttgtcgatccaa
atggcaaatgccaaatttaactatggctttgagtacctgggtgttcaggacaagctggtc
cagacccccctcaccgaccgctgctatttgaccatgacacaagccttggaggccaggctg
ggggggtcccctttcgggccggccgggactgggaagacagagtccgtcaaagctcttggc
catcagcttggacgctttgttttggtcttcaactgcgatgaaacctttgatttccaggcg
atgggacggatctttgtggggctctgccaggtgggtgcgtggggctgctttgacgagttc
aaccgcctggaggagcggatgctgtcagccgtgtcgcagcaggtgcagtgcattcaggaa
gcgctgcgcgagcactccaaccccaactgcgataagacctctgcccccattacttgtgag
ctgctcaacaaacaggtgaaggtgagtccagacatggccatcttcatcaccatgaacccc
ggctacgcaggcaggtccaaccttcccgacaatctgaagaagctcttccggagcttggcc
atgaccaagcccgaccggcagctcatcgcccaggtcatgctgtactcacagggcttccgc
actgctgaggtcctcgccaacaaaatcgtcccgttcttcaaactatgtgacgagcagctc
tcctctcagagccactatgactttggtcttcgagctttgaagagtgtgctggttagtgcg
ggaaacgtgaagagggagagaattcagaagattaagagggagaaagaagagcgaggggaa
gcagttgatgaaggagaaattgcagaaaatctacctgaacaggagattctgatacagagc
gtctgcgagacgatggtgcccaagctggtggcagaagacatcccactgctcttcagcctc
ctgtcagacgtgttccccggagtccagtaccaccggggcgaaatgaccgcgctccgagaa
gagctgaagaaggtgtgccaggaaatgtacctgacgtacggagacggagaagaagtcggt
ggaatgtgggtcgagaaggtcctccagctctaccagatcacccagatcaaccacggcctg
atgatggtgggcccctcgggaagtgggaagagcatggcttggcgtgttctcctgaaggct
ttggagaggctcgagggcgtggagggcgtggcccacatcatcgaccccaaagccatcagc
aaagaccacctttatggaaccctggaccccaacaccagggaatggacggatgggctgttc
acacatgtcctgagaaagatcatagacaacgtgaggggcgagctgcaaaagcgccagtgg
attgtcttcgatggcgacgtggaccccgagtgggtggagaacttgaactcggtgctggat
gacaacaagcttctgactctgccaaatggcgagcgtctcagccttccgcccaatgtgcga
ataatgtttgaagtacaggacttgaaatacgccactctggccacggtgtcccgctgcggc
atggtctggtttagtgaggacgttctcagcacagacatgatcttcaacaacttcctggcc
aggctgcgtagcatcccgctggacgaaggggaggacgaggcccagcgccggcgcaagggc
aaagaggacgagggggaggaggcggcttccccaatgctgcagatccaaagggacgcggcc
acaatcatgcagccgtacttcacgtccaacggtctggtcaccaaggccctggagcacgcc
ttcaagctggagcacatcatggacctgacccgtctccgctgcctgggctcgctcttctcc
atgctgcaccaggcctgccgcaacgtggcccagtacaacgccaaccaccccgacttcccc
atgcagatcgagcagctggagcgctacgttcagcgatatttggtttatgccatactgtgg
tccttgtctggagatagtcggctgaaaatgagagcagagctgggtgaatacatcagaaga
atcacaacggtgccgttgcccgctgcacccaacataccgattattgattatgaagtgtcc
atcagcggagaatggtcgccatggcaggccaaggtgcctcagattgaagtggagacgcac
aaggtggcggcccctgacgtcgtcgtgccgactctggacaccgtccgccacgaagccctc
ttgtacacctggctggctgagcacaagccactggtcctgtgcgggccccccgggtctggc
aagaccatgaccctcttcagcgccctccgggccttgcccgacatggaggttgtgggtctt
aacttctcgagtgctaccactccagagctcctgctgaagacctttgaccactactgcgag
tacagacgcacccctaacggtgtggttttggccccggtgcaacttggaaagtggctggtg
ctattctgtgatgagatcaacttgccagacatggataaatacgggacacagagggtcata
tccttcatccgacagatggtggagcatggaggcttttaccgaacctcagatcaaacgtgg
gtgaagctggagaggatccagtttgtcggggcttgtaatccacccacggatcctggaaga
aagcccctctctcacagattcttgcgccacgtgccggtcgtgtatgtggattacccggga
cccgcctccctgacgcagatctacggcaccttcaaccgggccatgctgcggctcatcccg
tccctgcgcacgtacgcggagccgctcaccgccgccatggtggagttctacaccatgtct
caggagagattcactcaggacacacagccccactatatctactcaccccgtgagatgacg
aggtgggtacgagggatctttgaggccctgagacctctggaaaccctgcctgtggaaggc
ctcattcggatttgggcacacgaagccctccgtctcttccaagacagactcgtggaggac
gaggagaggcgctggacagacgagaacatcgatatggttgctctgaagcactttcccaac
atagacaaagagaaggcgatgagccggcccatcttgtacagcaactggctgtcaaaggat
tacatcccagtagaccaggaagaattgagagattacgtcaaggctaggctgaaagtcttc
tatgaagaagaacttgatgttcctctggtcctgttcaatgaagtgttagaccacgtgctc
aggatcgaccggatattccgccagcctcaaggccacttgcttctgattggtgtcagtgga
gcaggaaaaaccaccctgtcccgttttgtggcctggatgaatggtttgagtgtgtaccag
attaaggtgcacagaaagtacaccggggaagacttcgatgaagatcttcggacggtgctg
aggcgttccggctgtaagaacgaaaagatagcatttataatggatgagtccaacgtgtta
gattctggattcctggagcgaatgaatacccttctggccaacggggaggtccccggcctc
tttgaaggagatgagtacgccactctgatgacccagtgcaaagagggggcccagaaggag
ggcctgatgctggactcgcacgaggaactgtacaaatggttcaccagccaggtcatccgc
aacctccacgtcgtcttcaccatgaacccgtcctcggaggggctcaaggaccgcgcggcc
acctccccggcacttttcaacaggtgtgtgttgaactggtttggggactggtccactgaa
gcgctgtatcaagtgggcaaggaattcacgagtaaaatggacctggagaagccgaattac
attgtgcctgattacatgccgcttgtgtatgacaaactaccacagccgccgtcgcatcgg
gaagcgattgtaaacagctgtgtatttgttcatcagactcttcaccaggctaatgctcgg
ctagcgaagcgagggggccggacgatggccatcacacctcgccactacctggacttcatt
aaccactacgccaacctgttccacgagaagcggagcgagctggaggagcagcagatgcat
ttgaacgtcgggctcaggaagatcaaggaaaccgtcgaccaggtggaggagctgcggcgc
gacctgcgtataaagagccaggagctggaggtgaagaacgcggccgccaatgacaagctg
aagaagatggtgaaggaccagcaggaggccgagaagaaaaaggtgatgagccaagaaatt
caggaacagctgcacaagcagcaggaagtcattgcagacaaacagatgagcgtcaaagaa
gatctcgacaaggtggagcctgcagtcattgaggcccagaatgccgtgaagtcgataaag
aagcagcacctggtggaggtgcgatccatggccaacccccctgccgccgtgaagctggcg
cttgagtccatctgcctgctgctgggcgagagcaccacagactggaagcagatccgctcc
atcatcatgagggagaacttcatccccaccatcgtcaacttctccgcagaggagatcagc
gatgccataagggagaagatgaagaaaaactacatgtccaatccaagctacaactacgag
attgtcaaccgggcctccctggcctgcggccctatggtgaaatgggccatcgcgcagctc
aactacgccgacatgttaaagcgggtggagcccctgcgcaacgagctgcagaagctggag
gacgacgctaaggacaaccagcagaaggccaacgaggtggagcagatgatccgcgacttg
gaagccagcatcgcccgctacaaggaggagtacgcagtcctgatctcggaggcccaggcc
atcaaggcagacctggccgctgtcgaagcgaaggtaaaccggagcacggctctcctgaag
agcttgtctgccgaacgtgaacgatgggaaaaaacaagtgaaactttcaaaaaccagatg
tccaccatcgccggggactgcctcttgtcggccgcgttcatcgcctacgcgggttacttt
gaccagcagatgcgccagaacctgttcaccacgtggtcccaccacttacagcaggccaac
atccagttccgtacagacatcgcgcggaccgagtacctctccaacgccgacgagcgcctt
cgctggcaagccagctccctacccgctgacgacctgtgcacagagaacgccatcatgctg
aagcgcttcaacaggtacccgctgatcatcgacccctctggccaggccacagaattcatc
atgaatgagtacaaggaccgcaagatcacgcgcaccagcttcttagacgatgccttccgc
aagaacctggagagtgcgctgaggttcgggaacccccttctggtgcaggatgtggaaagc
tacgatccggttttgaatccagtgctgaaccgcgaagttcggcgaactggggggagagtg
ctgattaccctcggcgaccaggatatagacttgtcaccatcattcgtcatcttcctgtcc
acccgagatccaaccgtggagtttccgccagacctgtgttcccgcgttacctttgtcaac
ttcacggtcacccgcagcagcttgcagagccagtgtttgaatgaagtacttaaggcagaa
aggcctgatgtggacgaaaagcgttctgatcttcttaagcttcaaggagagttccagctg
cgtttacgccagctcgagaagtctctgctgcaagctctgaacgaggtgaaaggacgcatc
ttggacgacgacaccatcataacgaccctggagaacctcaagagagaggcggccgaggtg
acgaggaaagtggaggagacggacatcgtcatgcaggaggtggagaccgtgtctcagcag
tacctgccgctgtccaccgcctgcagcagcatctacttcaccatggagtccctgaagcag
atccacttcctgtaccagtactccctccagtttttcctggacatttaccacaacgtcttg
tacgagaacccgaacctcaagggcatcacagaccacacgcagcgcctctccatcatcacg
aaggacctcttccaggtggcgttcaaccgggtggccagaggcatgctgcaccaggaccac
atcaccttcgccatgctgctggcccgaatcaaactgaagggcaccatcggggagcccacc
tacgacgccgaattccagcacttcctgagagggaaggagatcgtcctgagtgctggctcg
acgcccaagatccagggcctgaccgtggagcaggccgaggccgttgtgaggttgagctgt
ctccctgccttcaaagatctgattgcaaaggttcaggccgacgagcaatttggcatctgg
ttggacagcagctccccagagcagacggtcccgtacctctggagtgaagaagccccctca
acacccatcgggcacgccatccaccgcctgctcctgattcaggctttccgccctgatcgc
ctgctggccatggcccacatgtttgtttccacaaacctcggggagtccttcatgtccatc
atggagcagcctcttgacctgactcacatcgtggacacagaggtaaagccgaatactcct
gtcctgatgtgctctgtgcctgggtatgacgccagcgggcacgtcgaagaccttgcagca
gaacagaacacgcagatcacttcaatcgcaatcggctcggccgaaggcttcaaccaagca
gataaagccatcaatacagccgtcaagtccggcaggtgggtgatgctgaagaacgtgcac
ctggccccggggtggttgatgcagctggagaagaagcttcactccctgcagccgcacgcc
tgcttccggctgttcctcaccatggagattaatcccaaggtgcccgtgaacctgctccgc
gcaggccgcatcttcgtgtttgagccacccccgggggtgaaggccaacatgctgaggaca
ttcagcagcatccccgtctcccgcatttgcaagtctcccaatgagcgtgctcgcttatac
ttcctgctggcctggttccatgccatcatccaagaacgcttacgatatgcacccctgggg
tggtcaaagaagtatgaatttggggagtctgacctgcggtcggcctgcgacacggtagac
acgtggctggatgacacggcaaagggcaggcagaacatctcgccagacaagatcccgtgg
tccgcactgaagaccttgatggcccagtccatctacggcgggcgggtggacaacgagttc
gatcagcgtctgcttaacactttcctggagcgtctgttcacgacgaagagtttcgatagt
gaatttaagctggcctgcaaggtcgacgggcacaaagacattcaaatgcccgacggcatc
aggcgagaggagttcgtgcagtgggtggagctgctccccgacacgcagacgccctcctgg
ctgggcctgcccaacaacgcggagagagtcctgctcactacccagggcgtggacatgatc
agcaagatgctgaagatgcagatgctggaggacgaggatgacctggcctacgccgagacg
gagaagaaggccaggacggactccacgtccgacggccggcccgcctggatgaggaccctg
cacaccaccgcgtccaactggctgcacctcatcccccagacgctgagccacctcaagcgg
acggtggagaacatcaaggaccctttgttcaggttctttgagagagaagtgaagatgggg
gctaaactacttcaggacgttcgccaggacctcgcggacgtcgtccaagtgtgtgaaggg
aagaagaagcagaccaactacctgcgcacgctcataaacgagctggtcaaagggatcttg
cctcggagctggtcccactacacggtgcccgcgggcatgaccgtcatccagtgggtggcc
gacttcagcgagaggatcaaacagctacagaacatctctctggcggctgcgtctggcggc
gcgaaggagttgaagaacatccacgtgtgcctgggcggcctgttcgtgcccgaggcctac
atcaccgccaccaggcagtacgtggcccaggccaacagctggtccttggaggagctctgc
ctggaagtcaacgtcaccacgtcccagagtgccaccctcgatgcctgcagctttggggtc
acggggttgaagctccagggggccacgtgcaataacaacaagctgtcgctgtcccacgcc
atctccacagtcctccctctgacgcagctgcgctggctcaagcagaccaacgcagagaga
aaggctaacgtagtgaccctgcccgtctacctgaacttcacccgtgcggacctcatcttc
acggtcgattttgagatcgccaccaaggaggatccacgtagcttctacgagcgtggcgtc
gccgtcctctgcacggagtga

KEGG   Felis catus (domestic cat): 101089708
Entry
101089708         CDS       T02385                                 
Symbol
DYNC1I2
Name
(RefSeq) cytoplasmic dynein 1 intermediate chain 2 isoform X4
  KO
K10415  dynein cytoplasmic 1 intermediate chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101089708 (DYNC1I2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101089708 (DYNC1I2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101089708 (DYNC1I2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101089708 (DYNC1I2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101089708 (DYNC1I2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101089708 (DYNC1I2)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101089708 (DYNC1I2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 101089708
NCBI-ProteinID: XP_006935422
Ensembl: ENSFCAG00000004593
LinkDB
Position
C1:162845653..162905384
AA seq 612 aa
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKETVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQV
DFPPREIVTYTKETQTPVMAQPKEDEEEEDDVVTPKPPIEPEEEKTLKKDEENDSKAPPH
ELTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLS
LNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPE
YVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYC
VNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVHKQSKAVAVTSMSFPVGDVNN
FVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFDWTV
KLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASIS
VEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRA
DAEEEAATRIPA
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtcggacaaaagtgaattaaaggcagaattggaacgtaagaagcagcggttggcccaa
atcagagaggaaaagaagagaaaagaagaagaaaggaaaaaaaaggaaactgatcagaag
aaggaaacagttgctcctgtgcaagaagaatccgatcttgaaaaaaaaagaagagaagct
gaagcattgcttcaaagcatggggctaactccagaatcccccattgtccctcctcctatg
tctccatcctccaaatctgtgagcacaccaagtgaagctggaagccaagactctggagat
ggcgcagtgggatctagacgaggacctattaaacttggaatggctaaaattacacaagtt
gactttcctcctcgagaaatcgtcacatatacaaaggaaactcagactccagttatggct
cagcccaaagaagatgaagaggaagaagatgacgtagtgactcctaaaccacctattgaa
cctgaagaagagaaaactttaaagaaagatgaagaaaatgatagtaaagctccccctcat
gagctgactgaagaagaaaagcaacaaatcttacactcggaggagtttttaagtttcttt
gaccattctacacgaattgtagaaagagctctttctgagcagattaacatcttctttgac
tacagcggaagagatttagaagacaaagaaggagagattcaagcaggtgctaaactgtca
ttaaatcgacaattttttgatgaacgttggtcaaaacatcgtgttgttagttgtttggat
tggtcatctcagtatccagagctactcgtggcttcctataataacaatgaagatgctcct
cacgagccggatggtgtggcccttgtatggaatatgaaatacaaaaaaactacccccgaa
tatgtgtttcactgccagtcagctgtgatgtctgctacgtttgcaaaatttcatccaaat
ctggttgttggtggtacatattcaggccaaattgtgctgtgggataaccgtagcaataaa
agaactccagtgcagagaactccgctgtcagctgctgcacacacacatcctgtatattgt
gtaaatgttgttggaacacaaaatgctcacaatctgattagcatatctactgatggaaaa
atttgttcatggagtctggacatgctttcccatccacaggatagcatggaattggttcat
aaacagtcaaaggcagtagctgtgacatctatgtccttccctgttggagatgtcaacaac
tttgttgttgggagtgaagaaggttccgtgtacacagcatgccgccatggcagcaaagct
ggaatcagtgagatgtttgagggacatcaaggaccaatcactggtatccattgtcatgca
gctgttggagcagtggacttctcacatctttttgtcacttcatcatttgactggacagta
aaactttggacaactaagaataacaagcctttgtattcatttgaagataattcagactat
gtttatgatgttatgtggtcacccacccacccagccctgtttgcttgtgtggatggcatg
gggaggctggatttgtggaatctcaataatgacactgaggtgccaactgccagcatttct
gtggagggtaatcctgctcttaatcgtgtaagatggactcattctggaagagagattgct
gtgggtgattctgaaggacagattgtcatatatgacgtgggagagcagattgctgtcccc
cgaaatgatgaatgggcacggtttggccgaacgcttgcagaaattaatgcaaaccgagct
gatgcagaggaggaagcagctacccgaatacctgcttag

KEGG   Felis catus (domestic cat): 101092506
Entry
101092506         CDS       T02385                                 
Symbol
DYNC1I1
Name
(RefSeq) cytoplasmic dynein 1 intermediate chain 1 isoform X4
  KO
K10415  dynein cytoplasmic 1 intermediate chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101092506 (DYNC1I1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101092506 (DYNC1I1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101092506 (DYNC1I1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101092506 (DYNC1I1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101092506 (DYNC1I1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101092506 (DYNC1I1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101092506 (DYNC1I1)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40 His_Phos_1
Other DBs
NCBI-GeneID: 101092506
NCBI-ProteinID: XP_003982829
Ensembl: ENSFCAG00000011808
LinkDB
Position
A2:100583265..100897040
AA seq 608 aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETE
ALLQSIGISPEPPLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRRRLHRLGVSKVTQVD
FLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKVGHDSELENQDQKQEVKEAPPRELT
EEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNR
QFYDEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVF
HCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNV
VGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVV
GSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLW
TTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEG
ASALNRVRWAQAGKEVAVGDSEGRIWIYDVGELAVPHNDEWTRFARTLVEIRANRADSEE
EGTVELSA
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtctgacaaaagtgacttaaaagctgagctagagcgcaaaaaacagcgcttagcacag
ataagagaagagaagaaacggaaggaagaagagaggaaaaagaaagaggctgatatgcag
caaaagaaagaacctgttcaggacgactctgatctggatcgcaaacgcagagagacagag
gctcttttgcaaagcattggtatatcaccggagccccctctagtcccaacccctatgtct
ccctcctcgaaatcagtgagcactcccagtgaagctggaagccaagactcaggagacctg
ggaccattaacaagacgaagactgcacaggctgggtgtgtcgaaggttacccaggtggat
tttctgcccagggaagttgtgtcgtactccaaggagactcagactcctctggctacacat
cagtctgaagaggatgaggaagatgaggaaatggtagaacctaaagttggccatgattca
gaactggaaaaccaagaccaaaaacaggaggtgaaagaagcccctccacgggagctgaca
gaggaagaaaaacagcagatccttcattcagaggaatttctcatcttttttgatcggaca
atacgggtaattgaaagagcactagcagaagactctgacatcttctttgactacagcggt
cgagagttagaggaaaaagatggggatgtccaggctggagccaacctttctttcaatcgt
caattctacgatgagcattggtccaagcaccgagtagtcacttgcatggactggtccctg
cagtaccccgagctgatggttgcttcctacaacaacaatgaagatgctccccatgaacca
gatggagtggctttggtctggaacatgaagtttaagaaaaccacaccagaatacgtcttt
cactgtcagtcctctgtgatgtcagtgtgcttcgctcgtttccatcccaacttggtggtt
ggtgggacttactcgggccagattgtcctgtgggataatcgcagtcatcgaaggacacca
gtgcagaggacacccttgtcagctgctgcacacacccatcccgtgtactgtgtaaatgtt
gttgggacccagaatgctcataacctcatcactgtctctaccgatggtaaaatgtgttcc
tggagcctggacatgctctcaactccacaggagagcatggagctggtgtacaataagtcc
aagcctgtggctgttaccggaatggctttcccgacgggagacgtcaataacttcgtggtt
ggcagtgaggagggtacggtctacacagcctgccgtcatggaagcaaagcaggtattggt
gaggtctttgaaggtcaccaagggccagtgactggaattaactgccacatggctgtgggc
ccaattgacttttcacacctgtttgtcacgtcatcatttgactggaccgtcaaactgtgg
accacaaagcacaacaagccgctctactcctttgaagacaatgcagactatgtgtacgat
gtcatgtggtcccccgtgcatcccgcgctctttgcctgcgtggacgggatggggcgcctg
gacctctggaacctcaacaatgacaccgaggtcccgacagcaagtgtggccattgaaggg
gcttctgccctaaaccgtgttcgttgggctcaagccgggaaagaagttgccgttggagac
tcagaaggccgaatttggatctacgatgttggagagcttgcagttccccacaatgatgaa
tggacccgatttgccaggaccctcgtggagattcgtgccaacagagctgatagcgaggag
gaaggcaccgttgagttatctgcctaa

KEGG   Felis catus (domestic cat): 101093542
Entry
101093542         CDS       T02385                                 
Symbol
DYNC1LI1
Name
(RefSeq) LOW QUALITY PROTEIN: cytoplasmic dynein 1 light intermediate chain 1
  KO
K10416  dynein cytoplasmic 1 light intermediate chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101093542 (DYNC1LI1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101093542 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101093542 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101093542 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:fca03036]
    101093542 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101093542 (DYNC1LI1)
Membrane trafficking [BR:fca04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    101093542 (DYNC1LI1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101093542 (DYNC1LI1)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101093542 (DYNC1LI1)
SSDB
Motif
Pfam: DLIC ABC_tran Roc RsgA_GTPase AAA_16 PduV-EutP G-alpha DUF815 TsaE AAA_7 NACHT
Other DBs
NCBI-GeneID: 101093542
NCBI-ProteinID: XP_003992247
Ensembl: ENSFCAG00000007914
UniProt: M3W8M1
LinkDB
Position
C2:complement(150521360..150558113)
AA seq 524 aa
MAAVGRVGSFGSSPPGLASTYAGGPLANELTSGNGGAAAGDDEDGQNLWSCILSEVSTRS
RSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYFNVHDEDRDDQTRCNVW
ILDGDLYHKGLLKFSLDAISLKDTLVMLVVDMSKPWTALDSLQKWASVIREHIDKLKIPP
EEMKEMEQKLIRDFQEYVEPGEDFPASPQRRNTGSQEDKDDSVVLPLGADTLTHNLGIPV
LVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRK
FVHEKEIVAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVGSGSPGGGAGGGSSGL
PPSAKKSGQKPVLSDVHAELDRIARKPVTVSPTTPTSPTEGEAS
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcggctgtggggcgagtcggctccttcggttcctctccgccgggattagcctccact
tacgcaggcggccccttggctaacgagctaacatcgggcaacggcggcgccgcagcaggc
gacgacgaggacgggcagaacctttggtcctgcatcctcagcgaggtctccacccgctcg
cgctccaagctccccgcagggaagaacgtattgctgcttggtgaagatggagctggaaaa
acaagcttaataagaaaaattcagggaatagaagagtataagaaaggaagaggattggaa
tatttgtacttcaatgttcacgatgaagaccgagatgatcaaacaagatgtaatgtatgg
atcttagatggagacctgtatcacaagggcctcctgaaattttcactggatgccatttct
ctgaaggacactctagttatgctggttgttgatatgtcaaagccttggactgctttggat
tctttacagaaatgggcaagtgttattagagaacatattgacaagttgaaaattcctcct
gaagaaatgaaagaaatggaacaaaagttgattagagacttccaagaatatgtagagccg
ggagaagattttccagcctctcctcagagaagaaataccgggtcacaggaagataaagac
gacagtgtggttttacctctgggtgcggacacacttacacataacttgggcatcccagta
ctagtagtttgcacaaagtgtgatgccattagtgtattggagaaagaacatgactacaga
gatgaacattttgattttattcagtcacatatccggaagttttgtttacagtatggtgca
gcacttatttacacttcagtaaaagaaaacaaaaatatagatttagtatataaatatatc
gttcagaaactgtatggatttccctataagattcctgctgttgttgtggaaaaagatgca
gtatttatcccagcagggtgggataacgataagaaaataggaatattacatgaaaatttt
caaacattgaaagcagaagataattttgaagacattataaccaaaccacctgtccgaaag
tttgtacatgagaaggaaattgtggcagaagatgaccaagtgtttcttatgaagctacag
tcccttttagcaaagcaaccaccaactgcagctggaaggcctgtggatgcctcaccaaga
gtcccaggaggctcccctcggacaccaaatcgatctgtgtcgtccaatgttgccagcgtg
tcgcccatccctgccgggtcaaaaaaaattgatccgaacatgaaagctggagctacaagt
gaaggggtcctggcaaatttcttcaatagtttgctgagtaaaaagactggttctccggga
ggccctggtgttggcagtggtagccctggaggtggagctggaggtggaagcagtggttta
ccaccatccgccaaaaaatcaggccagaagcctgtcctatcagatgttcatgcggaacta
gacagaattgcacgcaaaccagttacagtttcccctacaacacctacatctcctacggaa
ggagaagcttcttga

KEGG   Felis catus (domestic cat): 101095299
Entry
101095299         CDS       T02385                                 
Symbol
DYNC1LI2
Name
(RefSeq) cytoplasmic dynein 1 light intermediate chain 2
  KO
K10416  dynein cytoplasmic 1 light intermediate chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04962  Vasopressin-regulated water reabsorption
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101095299 (DYNC1LI2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101095299 (DYNC1LI2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095299 (DYNC1LI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095299 (DYNC1LI2)
   03036 Chromosome and associated proteins [BR:fca03036]
    101095299 (DYNC1LI2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095299 (DYNC1LI2)
Membrane trafficking [BR:fca04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    101095299 (DYNC1LI2)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      101095299 (DYNC1LI2)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     101095299 (DYNC1LI2)
SSDB
Motif
Pfam: DLIC ABC_tran AAA_22 AAA_16 Arf PduV-EutP AAA_7 AAA_29 Roc AAA_24 NACHT ATPase G-alpha AAA_25 SRP54
Other DBs
NCBI-GeneID: 101095299
NCBI-ProteinID: XP_003998156
Ensembl: ENSFCAG00000015252
UniProt: M3WVF5
LinkDB
Position
E2:complement(44558537..44584233)
AA seq 492 aa
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLPETLVIFVADMSRPWTVMESLQKWASVLREHIDKMKIPPEEMRELERKFVKD
FQDYIEPEEGCQGSPQRRGPLTSGPDEENVALPLGDNMLTHNLGIPVLVVCTKCDAVSVL
EKEHDYRDEHFDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFITPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQ
VFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSAAKKSGQKTVLTNVQEELDRMTRKPD
SMVTNSSTENEA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaagctgctgctgggccccaacgggcccgccgtggcg
gctgccggcgacctgaccagcgaggaggaagagggccagagcctatggtcctcgattctg
agcgaggtgtccactcgcgctagatccaagctgccgtccggcaagaacatcctggtcttc
ggtgaagatggttctggtaaaacaaccctcatgactaaacttcaaggagctgagcatggc
aaaaaaggaagaggcctagagtatctctacctcagcgtccatgatgaggaccgagatgat
catacacgctgcaacgtgtggattctggatggagacctgtatcataaaggtctgctgaag
tttgcagtttctgctgagtccttgccggagaccctggtcatttttgttgcagacatgtct
aggccttggactgtgatggaatctcttcagaaatgggctagtgttttacgtgagcacatt
gataaaatgaaaattccaccagaagaaatgagggagctggaacggaagtttgtgaaagat
tttcaagactatattgagcctgaagaaggttgtcaaggttccccgcagagaagaggacct
ctgacctcaggtcctgacgaagaaaatgttgccctgcctcttggtgacaatatgctgact
cataacctgggaatcccagtgttggtggtgtgcacaaagtgtgatgcagtgagtgtcctg
gagaaggagcatgattacagggacgagcactttgacttcatccagtcacacctacggagg
ttctgcctccagtatggagcagccttgatttacacatcagtgaaggaggagaaaaacctc
gacttgttgtataagtacattgttcataaaacgtatggcttccactttatcacacctgcc
ttagttgtggaaaaggatgcagtttttatacctgcaggctgggacaacgaaaagaaaata
gctattttacatgaaaatttcacaactgtgaagccagaagatgcatatgaagattttatt
gtgaaaccacctgtgagaaagctggtccatgacaaagagttggcagccgaggatgagcag
gtgttcctaatgaagcaacagtcactccttgccaagcagccagccacgcccacgagagct
tctgaatcccctgcgagaggaccctctggctctccaagaactcagggccggggagggcca
gcaagtgtgcctagtgcttccccgggcacatcagtaaagaagccggacccaaacatcaaa
aataacgcagcaagtgaaggtgtgttggccagcttcttcaatagtctgctgagtaaaaag
acaggttctcctggaagtcctggtgctggtggtgtgcagagcgcagccaagaagtcagga
caaaagactgtgttgacaaatgttcaggaagaactggatagaatgactcgaaaaccagac
tccatggtaacaaactcttcaacagaaaatgaagcctga

DBGET integrated database retrieval system