KEGG   Felis catus (domestic cat): 101082033
Entry
101082033         CDS       T02385                                 
Symbol
PLA2G4A
Name
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101082033 (PLA2G4A)
   00565 Ether lipid metabolism
    101082033 (PLA2G4A)
   00590 Arachidonic acid metabolism
    101082033 (PLA2G4A)
   00591 Linoleic acid metabolism
    101082033 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    101082033 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082033 (PLA2G4A)
   04014 Ras signaling pathway
    101082033 (PLA2G4A)
   04370 VEGF signaling pathway
    101082033 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    101082033 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082033 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082033 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    101082033 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    101082033 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082033 (PLA2G4A)
   04913 Ovarian steroidogenesis
    101082033 (PLA2G4A)
   04921 Oxytocin signaling pathway
    101082033 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082033 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082033 (PLA2G4A)
   04726 Serotonergic synapse
    101082033 (PLA2G4A)
   04730 Long-term depression
    101082033 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082033 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082033 (PLA2G4A)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101082033 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 101082033
NCBI-ProteinID: XP_006942798
Ensembl: ENSFCAG00000001911
UniProt: A0A2I2U469
LinkDB
Position
F1:complement(23603683..23762818)
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEVTLMDANYVMDETLGTATFPISSIRVGEKKEV
PFIFNQVTEMFLEMSLEVCSSPDLRFSMALCDQEKTFRQQRKENIKENMKKLLGPEKSGG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYVAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYIESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNSAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQNKGSTMEEE
LENITAEHIVSNDSSDSDDESQEPKGTENEDAKREYQNDNQASWVHRMLMALVSDSTLFN
TREGRAGKVHNFMLGLNLNTSYPISPLKDFTTQESLDEDELDTAVADPDEFEQIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMN
KLPFPKIDPNVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRNYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPAA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccagtattcccacaagttc
acagtagtggtgttacgtgccaccaaagtgacaaagggggccttcggtgacatgcttgat
accccagatccctatgtggaacttttcatctcctcaacccctgacagcaggaagagaaca
agacacttcaataatgacataaacccagtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggaggtcacattaatggatgccaattatgtcatggatgaa
actctaggaacagcaacattccccatatcctctatcagagtgggagagaagaaagaggtt
ccttttattttcaaccaagtcactgaaatgtttctggaaatgtctcttgaagtttgttca
tccccagacctccgattcagtatggctctgtgtgatcaggagaagactttcagacaacag
aggaaagaaaacataaaggaaaacatgaagaaactcctgggtccagagaagagtggaggc
ctgtattctacgcgcgatgtgcctgtggtggccatactgggctcaggtggagggttccga
gccatggtcggattctccggtgtgatgaaggcactatatgaatcaggaattttggactgt
gctacttacgttgcgggcctttctggctccacatggtacatgtcaaccttatattctcac
cccgattttccagagaaagggccagaggagattaatgaagagctaatgaaaaatgttagc
cacaacccccttttacttctcacaccacagaaagttaagagatacattgagtctctatgg
aagaagaaaagctctgggcaacctgtcacctttactgacatctttgggatgttaattgga
gaaacactaattcacaatagaatgaacactaccttgagtagtttgaaggaaaaagtcaat
tctgcacaatgccctttaccccttttcacctgtctccacgtcaaacctgatgtttcggag
ctaatgtttgcagattgggttgaatttagtccatatgagattggcatggctaaatatggt
acttttatggctcctgacttatttggaagcaaattttttatgggaacagttgtgaagaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgcgttttctatattg
ttcaacagagtcttgggagtttctggctcacaaaataaaggttccacaatggaggaagaa
ctagaaaatattacagcagagcatattgtgagtaatgacagctcggatagcgatgatgaa
tcacaagaacccaaaggcactgaaaatgaagatgctaaaagggaatatcaaaatgataac
caagcaagttgggtccatcgtatgttaatggctttggtgagtgattcaactttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgttgggcttgaatctcaataca
tcctatccaatatctcctctgaaagactttaccacacaggaatcattggatgaagatgaa
ttggatacagctgttgcagatcctgatgaatttgagcaaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtggcctcacatttaacctgccataccccttg
atcctgagacctcagagaggagtcgatctcattatctcctttgacttttctgcacgacca
agtgactctagtcctccattcaaggaacttctccttgcagaaaagtgggccagaatgaac
aagcttccatttccaaagattgatcccaatgtgtttgatcgagaaggactgaaggaatgc
tatgtctttaaacccaagaatcctgacgttgagaaagattgcccaactatcatccacttt
gttctggccaacatcaacttcagaaattacaaggcaccaggtgtcccaagagaaactaag
gaagagaaagaaatagctgattttgatatttttgatgaccccgaatcaccattttcaacc
ttcaactttcaatatccaaatcaagcattcaaaaggctgcatgatctcatgtacttcaat
accctgaacaacattgatgtgataaagaacgccatagttgaaagcattgaatacagaaga
cagaatccgtctcgttgctcggtttctcttagtaatgttgaagcaagacgattcttcaac
aaggaatttctaagcaaacctgcagcatag

KEGG   Felis catus (domestic cat): 101082574
Entry
101082574         CDS       T02385                                 
Symbol
PLA2G4F
Name
(RefSeq) cytosolic phospholipase A2 zeta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101082574 (PLA2G4F)
   00565 Ether lipid metabolism
    101082574 (PLA2G4F)
   00590 Arachidonic acid metabolism
    101082574 (PLA2G4F)
   00591 Linoleic acid metabolism
    101082574 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    101082574 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082574 (PLA2G4F)
   04014 Ras signaling pathway
    101082574 (PLA2G4F)
   04370 VEGF signaling pathway
    101082574 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    101082574 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082574 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082574 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    101082574 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    101082574 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082574 (PLA2G4F)
   04913 Ovarian steroidogenesis
    101082574 (PLA2G4F)
   04921 Oxytocin signaling pathway
    101082574 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082574 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082574 (PLA2G4F)
   04726 Serotonergic synapse
    101082574 (PLA2G4F)
   04730 Long-term depression
    101082574 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082574 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082574 (PLA2G4F)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101082574 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 101082574
NCBI-ProteinID: XP_011281358
Ensembl: ENSFCAG00000009311
UniProt: M3XAF2
LinkDB
Position
B3:63200833..63216125
AA seq 849 aa
MLWALWPRWLAGKGLPLLGAVLLRKRDKRGPQWRQWRRETHPYYDLQVKVLRARNIQGTD
LLSKADCYVELRLPTASPSPAQTRMVANCSDPEWNETFHYQIHGAVKNVLELTLCDKDIL
GSDQLSLLLFDLRSLKPGQPYRHIFPLNHQDSQELQVEFVLENSQVPASEVITNGVLVAQ
PCLRIQGTLREDGTAPHREYGSRQIQLTVPGAYEKPQFLPLQPPMEGGLPATFTFHVNPV
ISSRLDVELGERLTVLQSGPSVELEAHTNKLGEGGILLSSLALGQEEQRFVALGEGQEVV
LSMKAEMSSGDLDLRLGFGLCDGEREFLDKRKQIVSKALQQVLGLSQAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYKDPAWSQVALQGPIE
RAQARVCSSKMGAMSTERLQYYAQELGSLESTGHRVSLIDIWGLLIEYFLYQEKNPAKLS
DQQEAVNQGQNPYPIYASINVHTNISGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSEFF
MGHLLQPQPEPRICYLQGVWGSAFAASLDEIFLKTAGSGLSFLDCHRGSVNITDDCQKLQ
LHDPTRLRTRLFTRQGPFSQAVLDIFTSRFTFAENCNFTRGLCLHKDYVAGREFMAWKDT
HPDAFPNQLTPMRDCLCLVDGGFAINSPFPLSLLPQRAVDLILSFDYSLEAPFEVLQMTE
KYCLDRGIPFPSIEVLPEDLEEPRECYLFAKAKDPRSPIVLHFPLVNRTFCTHLAPGVER
QTAEEKAYGDFVVNGADTPYGMMNFTYEPEEFERLVALSRYNVLNNVETLRHALQLALER
RQAGGRAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcgctctggccaaggtggctggcaggcaaggggctgcccctcctgggggca
gtgctgctgcggaagagagacaagaggggacctcagtggaggcaatggaggcgggaaacc
cacccctactatgacctccaggtgaaggtgctgagggccagaaatatccagggcacagat
ctcttgtccaaagctgactgctatgtggaactgcgcctgcccactgcgtcccctagccct
gcccagacaaggatggtggctaactgcagtgaccctgagtggaacgagaccttccactac
cagatccatggtgctgtgaagaatgtcctggagctcaccctctgtgataaggacatcctg
ggcagtgaccagctctccctgctactctttgacctgaggagcctcaagcctggccaaccc
tacagacacatcttcccactcaaccaccaggattcacaggagctgcaggtggaatttgtt
ctggagaacagccaggtgcctgcgtctgaagtcatcaccaatggagtcctggtggctcag
ccctgtctgagaatccaggggaccctcagggaagacgggacagccccacatcgagagtat
ggatctaggcagattcagctgacagtgcccggggcctacgagaagccacagttcttgccc
ctgcaacctcccatggagggaggcctcccagctaccttcacctttcacgtgaacccagtg
atcagctccaggctggatgtggagctgggggagaggctcacagtcctgcaaagtggtcca
agtgttgagctggaggcccacaccaacaagctgggtgaggggggtatcctgctctcttct
ctggccctaggccaagaggaacagcgctttgtggccctaggggagggccaggaggtggtt
ctgagtatgaaggcagaaatgagctctggagaccttgacctgcgtcttggttttggcctg
tgtgatggggaacgggagtttctggacaagaggaagcagatcgtgtccaaggccctgcag
caggttctgggtttgagccaggcgcctgacagtggccaggtgcctgtggtggctgtgcta
ggttcgggaggtggaacccgagccatgtcttccctgtacggaagcctggcagggctgcag
gaacttggcctcctggacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacaaggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggctcgggtctgcagcagtaagatgggggcgatgtccacggagcgcctacaa
tactatgcccaggaactggggagcctggaaagcactggccacagagtttccctcatcgac
atctggggtctcctcattgaatatttcctctaccaggagaaaaaccctgccaagctgtct
gaccagcaggaggctgtcaaccagggccagaacccttatcctatctacgccagcatcaat
gtccacaccaacatcagtggggaagacttcgcagaatggtgcgagttcacaccctatgag
gtcggcttccccaagtacggggcttatgttcccactgagctctttggctctgagttcttc
atggggcatctgctgcagccccagcccgagccccggatctgctacctgcagggtgtgtgg
ggcagcgcctttgcagccagcctggatgagatcttcctgaagactgccggctcgggcctc
agcttcctagactgccacagagggagtgtaaacatcacagatgactgtcagaagctccag
ctgcacgatcccacacgtctgaggaccaggctcttcacccgccaggggcccttctcccag
gccgtgctggacatcttcacctcccgctttaccttcgcggagaactgtaatttcaccagg
ggcctctgcctgcacaaagactatgtggctggccgggagttcatggcctggaaagatacg
caccctgacgctttccccaaccagctcactcccatgcgggactgcctgtgcctggtggat
gggggctttgccatcaactctccgttcccactcagcctgctgccccagagagcggtggac
ctcattctgtcctttgactactccctggaggcccctttcgaggtcttacagatgacagag
aagtactgcctggaccgaggcatccccttcccaagtatcgaggtgctccccgaggacttg
gaggaaccccgtgagtgctacctgttcgccaaggccaaggacccccgctctcccatcgtg
ctgcactttcccctcgtcaaccgtaccttctgcacacacctggccccaggtgtggagcga
caaacagccgaggagaaggcctacggggactttgtggtcaatggggcagacactccatat
ggcatgatgaacttcacctatgagcctgaggagtttgagcggctggtggctctgagtcga
tacaatgttctgaacaatgtggagaccttgcggcatgcgctccagctggctctggagcga
aggcaggctgggggcagggccggaggctga

KEGG   Felis catus (domestic cat): 101082828
Entry
101082828         CDS       T02385                                 
Symbol
PLA2G4E
Name
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101082828 (PLA2G4E)
   00565 Ether lipid metabolism
    101082828 (PLA2G4E)
   00590 Arachidonic acid metabolism
    101082828 (PLA2G4E)
   00591 Linoleic acid metabolism
    101082828 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    101082828 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082828 (PLA2G4E)
   04014 Ras signaling pathway
    101082828 (PLA2G4E)
   04370 VEGF signaling pathway
    101082828 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    101082828 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082828 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082828 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    101082828 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    101082828 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082828 (PLA2G4E)
   04913 Ovarian steroidogenesis
    101082828 (PLA2G4E)
   04921 Oxytocin signaling pathway
    101082828 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082828 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082828 (PLA2G4E)
   04726 Serotonergic synapse
    101082828 (PLA2G4E)
   04730 Long-term depression
    101082828 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082828 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082828 (PLA2G4E)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101082828 (PLA2G4E)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 101082828
NCBI-ProteinID: XP_003987300
Ensembl: ENSFCAG00000007352
UniProt: A0A5F5XLL6
LinkDB
Position
B3:63282027..63342804
AA seq 862 aa
MTLQSSEGCPGLGTDVFAPQVLQGAEESRSERDVSEFEHTQDLETPSLPPLLPTALGGSQ
GGVSPCHLLTVKVIRMKNVRQADMVSQTDCFVSLWLPTASRERLRTRTISNCPNPEWNET
FSFQIQSQVKNVLELSICDEDTVTPNDHLLTVLYDLTKLCFRKKTHMKFPLNPEGMEELE
VEFLLEESPFPPETLITNGVLVSRQVSCLEVHAECRRQKKSRKMKDLLVTVKESFEHTQR
VSHCQEPCCPNLACFHYPKYFQPQMHVEVPKSQWSCGPCCCCARKNSPICQPLDCLPDGQ
AVTLPVGESCELHVKSTPCPQTLDVRLGFSLCQAELEFLQKRKVVVAEALKQVLQLEEDL
HTDEVPLIAIMATGGGARSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDPD
WSSKNLEPAIFEARRHVVKDKMPALFPDQLCKFQEELRQRSQEGYKVTFTDFWGLLIEAC
LGDERNECKLSDQRAALSQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEVGLQKYGAF
IPTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTRDK
VHDIEDEPLLPEIPKCDANILDTAVVIPGSWLSNTFRSILTHRSFVSEFHNFLLGLQLHT
DYLQNSQFSMWRDTVLDTFPNQLTGSVNHLCLLDTAFFVNSSYPPLLRPERKVDLIIHLN
YCAGSQTKPMKQTCEYCSVQNIPFPKYEVQEGDENLKECYLIENSQEPDAPIVIFFPLIN
DTFQKYKAPGVERSPEELEQGHVDIYGPKTPYATKELTYTEAAFDKLVKLSEYNILNNKD
KLFQALRLAVEKKKRLKSQCPS
NT seq 2589 nt   +upstreamnt  +downstreamnt
atgactctccagagctcggaaggctgtcctggcctgggaactgatgtgtttgccccacag
gtgctacagggggctgaagagagcaggtcggaaagagatgtcagtgagtttgagcacaca
caggacctggaaactcccagtctcccacctctgcttcccacggcccttgggggctctcag
ggtggggtctctccatgccacctgctgacagtgaaggtcatccggatgaaaaatgtccgg
caggctgatatggtgagccagacagactgctttgtgagcctttggctgcccaccgcttct
cgtgaaaggctgaggactaggaccatctccaactgcccaaacccagagtggaatgaaacc
ttcagcttccagatccagagccaagtgaagaacgtgctggagctgagcatctgtgatgaa
gacacagtgacaccaaatgaccacctgttgacagtcctctatgacctcaccaagctctgc
ttccgaaagaaaacccatatgaagttcccactcaacccagagggcatggaagagctggag
gtagagttcctgctggaggagagtccctttccacctgagaccctcatcaccaacggcgtg
ctggtgtctcgacaagtctcctgcctagaggttcatgcagaatgcaggaggcagaagaag
agcaggaaaatgaaggacctcctggtgacagtaaaggagtcctttgagcacacccagcgc
gtctcgcactgccaggagccctgctgcccgaacctggcctgcttccactaccccaagtac
ttccagccccagatgcacgtggaagtgcccaagagccagtggagctgtgggccctgctgc
tgctgtgcgcgcaagaacagccctatctgccagcccctcgattgccttcctgatggccag
gcggtgaccctgccggtgggtgagagctgtgagttacacgtgaagtctacaccctgcccc
cagacgcttgacgtgcggctgggcttcagcctatgccaggcagagctggagtttctgcag
aagcggaaggtggtggtggccgaggcactgaaacaggtgttgcagctggaggaggacctg
catacggacgaggtaccattgatagccatcatggccactgggggtggagcaagatccatg
accgccatgtacggccacctgctggggctgcagaagctgaacatcctgaactgtgccagc
tacatcactggcctgtcaggggccacctggaccatggctaccttgtaccgtgatcctgac
tggtcctccaaaaacctggagccggccatatttgaggcacggaggcatgtggtcaaggac
aagatgcctgccctattcccagaccagctctgcaaattccaggaggagcttcggcagcgc
agtcaggaaggctacaaggtcacctttacagatttctggggccttctgattgaggcctgt
ctgggggatgagagaaatgaatgcaaactgtcagatcagcgtgctgctttatcccagggc
cagaaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggat
ttcagagagtggtgcgagttctccccctacgaagtgggcctgcagaagtacggcgccttc
atccccactgagctcttcggatccgagttcttcatggggcggctgatgaaaaggatccca
gagtcaaggatgtgctacatgctaggtttgtggagcagcatcttctccctgaacttgctc
gatgcctggaatctgtcccatacctcagaggagtttttccacaggtggacgagggataaa
gtgcacgacattgaagatgagccactcctgcctgaaatccccaaatgtgatgccaacatc
ttggacaccgcggtggtgatcccagggtcctggttgtccaatactttccgcagcatcctc
acccataggtccttcgtgtctgagttccacaatttcctgttggggctgcagctgcacacc
gactacctccagaacagccagttctccatgtggagagacacggtgctagatactttcccg
aaccagctgacggggtccgtgaaccacttgtgcctgttggacactgcattctttgtcaat
tccagctacccgcccctccttaggcctgagagaaaagtcgacctcatcatccacctcaat
tactgtgctgggtcccagacaaagcccatgaaacaaacctgtgagtactgctctgtgcag
aatatccccttccccaaatacgaagtgcaagagggggacgaaaatctcaaggagtgctac
ctgatagagaactcccaagaacctgatgctcccattgtgattttcttcccactcatcaat
gacaccttccagaagtacaaggccccaggtgtggagaggagccccgaggagctggagcag
ggccacgttgacatttatggccccaaaactccgtatgctaccaaggagctgacatacaca
gaggccgcctttgacaagctggtgaagctctctgagtacaacatcctgaataacaaagac
aagctctttcaggccctgagactggcggtggagaagaagaaacgcctgaagagccaatgt
ccctcctaa

KEGG   Felis catus (domestic cat): 101082829
Entry
101082829         CDS       T02385                                 
Symbol
PLA2G4D
Name
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101082829 (PLA2G4D)
   00565 Ether lipid metabolism
    101082829 (PLA2G4D)
   00590 Arachidonic acid metabolism
    101082829 (PLA2G4D)
   00591 Linoleic acid metabolism
    101082829 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    101082829 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082829 (PLA2G4D)
   04014 Ras signaling pathway
    101082829 (PLA2G4D)
   04370 VEGF signaling pathway
    101082829 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    101082829 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082829 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082829 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    101082829 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    101082829 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082829 (PLA2G4D)
   04913 Ovarian steroidogenesis
    101082829 (PLA2G4D)
   04921 Oxytocin signaling pathway
    101082829 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082829 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082829 (PLA2G4D)
   04726 Serotonergic synapse
    101082829 (PLA2G4D)
   04730 Long-term depression
    101082829 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082829 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082829 (PLA2G4D)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101082829 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2 YscJ_FliF
Other DBs
NCBI-GeneID: 101082829
NCBI-ProteinID: XP_011281374
Ensembl: ENSFCAG00000007353
UniProt: A0A2I2U0T3
LinkDB
Position
B3:63249159..63270214
AA seq 814 aa
MERLTTRGPPGHPHQVEASACWRLTVKVLEARNLGWADLLSEADPYVTLQLPTAPGTKFK
TKTITNSSHPVWNETFSFLIQSRVKNILELNVYDEDPVTEDDACFKILYDVSEVLPGQLL
QKTFSLRPQGQEELDVEFLMEKTSERPENLITNNVLVARELSCLDVHLVSIGSTATVTDQ
DELELVLKGSYEDTQTSALGTASFRFHYMAAQEAELSGHLKRLERNAWTSDKSAEHLTVP
LRSLAMGKEVTINVPATNAPEVRLQLKTEGCPKELAMHLGFDLCAEEKAFLSRRKQVVAK
ALKQVLQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGISGS
TWTMAHLYGDPEWSQGDLKGPIKCAREHLAKSKLEAFSPERLASYCRELELRAKQGHPKT
FVDLWALVLESMLHGQVMDQKLSEQRAALERGQNPLPLYLSLNVKENHLETLDFKEWVEF
SPYEVGFLKYGAFVPSDLFGSEFFMGRLMRKLPESRICFLEGIWSNVLSLNLLDAWYDLI
SSDDTWKQHVKDKIKNLEESPASVRTSSRLEASWLQPGTTLAKVFKGFLTGRPLHQHSFN
FLRGLQLHQDYYSQRDFSTWADCELDSTPGQLTPQEPQLCLVDGGYFLNTSCPSMFRPGR
RLDLILSFDYSLSSPFKTLQQTELYCRARGLPFPRVDPNPQDQHQPTECHLFSDPTHPDT
PVLLHFPLVNASFKDHSAPGVLRSPTELPAGQVDLTGTASPYSLFNMTYKEEDFDRLLQL
SDYNVRNSQDAILQALRMAVKHRALGARPPTAQN
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggaaagactgacaactaggggaccacctggccatcctcaccaggtggaggcctctgct
tgctggcggcttactgtgaaggtcctggaggccaggaacctgggctgggctgacctgttg
agtgaggcagacccctacgtgaccctacagctgcccactgcacctgggacaaagtttaaa
accaaaacaatcaccaactctagtcatcctgtatggaatgagaccttcagtttcctgatc
cagagtcgggtcaagaatattctggagctaaacgtctatgatgaggacccagtcacggag
gatgatgcctgcttcaagattctctatgatgtctcagaagtcctccctggccagctgctc
cagaagaccttctccctgcgtccccagggacaggaggagctggacgtggagttcctgatg
gaaaaaacgtcagaacgcccagaaaacctcatcaccaacaacgtccttgtggcccgagag
ctgtcatgcctggatgtccatctggtcagcattgggagcacagccacggtcacagatcag
gatgagctggagttggtgctgaagggctcatatgaagacacacagacctctgcactaggc
acagcatccttccgcttccactacatggcagcccaagaggcagaactgagtgggcatctg
aagaggttggaaaggaatgcctggacttcagacaagtcagctgagcacctcactgtgcct
ctaaggtccttggccatgggaaaggaggtgaccattaacgttcctgctacaaacgcccca
gaagtgaggctgcagctcaagactgagggctgccctaaggaactggctatgcacctgggc
tttgatctgtgtgcagaggagaaagctttcctgagcaggaggaagcaggtggtggccaag
gctctcaagcaggtcttgcagctggacagagacctacaggaggatgaggtccctgttgtg
ggcataatggccacaggaggaggtgcccgggccatgacgtctctctacggccacctgttg
gccctacagaagctgggcctcctggactgtgtgacctacttcagtggcatctcaggctct
acatggacaatggcccacctctacggggacccggagtggtcacagggggacctcaaagga
cccatcaaatgtgctagagagcacctggccaagagcaaactggaggccttctccccagag
cgcctagcaagctactgccgggagctggagctgcgggctaagcagggccaccccaagacc
tttgtggacctgtgggctctcgtgctggagtccatgctgcatggccaggtgatggatcag
aagctgtcggaacagagagctgcactggagcggggccagaaccctctgcccctctacttg
agcctcaacgtcaaagagaaccatctggagaccctggacttcaaggagtgggtagagttt
tcaccctatgaggtggggttcctgaagtatggagcctttgtgccttctgatctctttggc
tctgagttcttcatggggcggctgatgaggaagctccctgagtcccggatctgctttctg
gaaggtatctggagcaacgttttgtccctgaacttgctggatgcctggtatgacctcatc
agctctgatgacacctggaagcagcatgtcaaggacaaaattaagaacctggaggagtct
cctgcctccgtgaggacctcctcacggctggaggcttcctggctgcaacccggaacaacg
ctggccaaggtatttaagggcttcctgacaggcaggccgctccaccagcatagcttcaac
ttccttcggggcctccagctgcaccaggactactatagccagagagacttctccacctgg
gcagactgtgagctagactccacccctggtcagcttacgcctcaggagccacagctctgc
ctggtagatggcggctacttcctcaacaccagctgtccctccatgttccggccaggccgc
agactggacctcatactctccttcgactactccctatcctcaccctttaagacgctgcag
cagactgagctgtactgccgggcccggggcctgccattccctcgcgtggaccccaaccct
caggaccaacaccagccaacagagtgccacctcttctcggaccccactcaccctgatacc
cctgtcctgctgcacttcccactggtcaatgcctccttcaaggaccactcagcccctggt
gtcctacgcagccccacagagctcccagctggccaggtggatctcactgggaccgcctca
ccctattccctattcaacatgacctacaaggaggaagattttgatcgcctgctgcagctt
agtgactacaatgtacggaacagccaggatgccattctgcaggccttgaggatggccgtg
aaacaccgggccctgggggccaggcctccaacagcacagaattga

KEGG   Felis catus (domestic cat): 101083342
Entry
101083342         CDS       T02385                                 
Name
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101083342
   00565 Ether lipid metabolism
    101083342
   00590 Arachidonic acid metabolism
    101083342
   00591 Linoleic acid metabolism
    101083342
   00592 alpha-Linolenic acid metabolism
    101083342
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101083342
   04014 Ras signaling pathway
    101083342
   04370 VEGF signaling pathway
    101083342
   04072 Phospholipase D signaling pathway
    101083342
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101083342
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101083342
   04664 Fc epsilon RI signaling pathway
    101083342
   04666 Fc gamma R-mediated phagocytosis
    101083342
  09152 Endocrine system
   04912 GnRH signaling pathway
    101083342
   04913 Ovarian steroidogenesis
    101083342
   04921 Oxytocin signaling pathway
    101083342
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101083342
  09156 Nervous system
   04724 Glutamatergic synapse
    101083342
   04726 Serotonergic synapse
    101083342
   04730 Long-term depression
    101083342
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101083342
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101083342
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101083342
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 101083342
NCBI-ProteinID: XP_006932682
Ensembl: ENSFCAG00000007350 ENSFCAG00000029596
LinkDB
Position
B3:complement(63489439..63506878)
AA seq 781 aa
MALAKVPGTCLLTIRVLQACGLPSKDLVTPSDCYVSLWLPTASSHRLQTRTVKNSRNPIW
NQSFRFRIHSQLKNVVQLQVFDQDLLTNDDPVLSVLFDVGTLRAGEFRRESFSLSAQGEE
RLEVEFRLQRLTDCAEQLVTNGILVARELSCLHVRLEEAGDRKESGGRVQLMVPGSCEGP
QEAAVGAGSFCFHCPACWEQELDIHLQDTPQEHLKVPLRALPSGQVVRLVFPTSQEPLMR
VELRKEDGPRELAVRLGCGPCAEEQAFLSKRKQVVAKALKQVLQLDEDLQEDEIPVVAVM
ATGGGIRAMVSLYGHLAGLKELGLLDCISYITGASGSTWALANLYEDPEWSQKDLAGPTE
SLKAQVTKSKLGVLAPSQLQQYRQELAERARLGHPPCFTNLWALISEALLHDEPHDHTLS
DQREALSQGQNPLPIYCALNTKEKNLTTFEFAEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGRVTKRLPESRICFLKGIWSNLYAASLQDSLYWASEPSQFWDRWAQDQANLDKEQVPL
LKIEEPPTGTSKIVEFFTDLLTRRPLAQATHNFLRGLQFHKDYFQQPYFSTWKATKLDGH
PNQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLILSLDYNLQGAFQQLQLLGRLCQE
QGIPFPPISPSPEEQRQPPECCLFSDPDRPDAPAVLHFPLVDASFREYSAPGIQRTPEEK
GAGEVNLSSSNSPYHYSKLTYSPEDMDKLLHLTHYNICNNQEQLLEALRGAVQRKRRQHR
P
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcctgctcaccattcgtgtcctgcaggcctgt
ggcctgccctcgaaggacctagtaaccccctctgactgctatgtgagtctgtggctgccc
acggcctctagccataggctgcagacacgcacggtcaagaacagcagaaaccccatctgg
aatcagagctttcgctttcgaatccacagccagctcaagaatgtggtgcagctgcaagtc
tttgaccaggaccttctgaccaatgatgaccccgtgttgtcggtgctatttgacgtgggg
actttgcgagctggggagttccgcagagagagcttctcactgagcgctcagggtgaggag
cggctagaagttgaatttcggctacagagactgacagactgtgctgagcagcttgtcacc
aatggcattctggtggcccgggagctctcttgcttgcatgttcgactggaggaggcaggg
gaccggaaggagtccgggggaagagttcagctcatggttcctgggtcctgtgagggtccg
caggaggccgctgtgggtgctggctccttctgcttccattgcccggcctgctgggagcag
gagctggatattcatctgcaggataccccccaagagcacctgaaggtgcccctgagggcc
ttgccctctgggcaggtggtgaggcttgtcttccctacgtcccaggaacccctgatgagg
gtggagctgagaaaagaagacggacccagggagctggctgtgcggctaggctgcgggccc
tgtgccgaggagcaggcctttctgagcaagaggaagcaggtggtggccaaggccctgaag
caggtcctgcaactggatgaagacttacaggaagatgagatccccgtggtagctgttatg
gccactggtggtgggatccgggcgatggtttccctgtatgggcatctggctggcctgaag
gagctgggtctcttggattgcatctcctacatcacaggggcctctggctctacctgggct
ttggccaacctctacgaggacccagaatggtctcagaaggacctggcagggcccaccgag
tcactgaaagcacaggtgaccaagagcaagttgggcgtgcttgctcccagccagctgcag
cagtaccggcaggagctggccgagcgtgcccgcctgggccacccgccctgcttcaccaac
ctgtgggccctcattagtgaggccctgctgcacgatgagccccatgaccatactctctca
gaccagagagaggccctgagtcaaggccagaaccctctgcccatttactgtgcccttaac
accaaggagaagaacctgaccacctttgaatttgctgagtggtgtgagttctccccttat
gaggttggctttcccaagtacggtgccttcatcccctccgagctctttggctctgagttc
ttcatggggcgcgtgaccaagcggcttcctgagtcccgaatctgcttcctgaaaggtatc
tggagcaatctgtatgcagccagcctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggcacaggatcaggccaatttggacaaggagcaggttcctctt
ctgaagatagaagagcctcccacggggaccagcaagattgtcgagttttttactgacctt
ctgacacggcgcccactggcccaggccacacataatttcctgcgtggtcttcagttccac
aaagactatttccaacagccttacttctccacctggaaagccaccaaactggatgggcac
cccaaccagctgacacctgcagagccccatctttgcctgctggatgttggctaccttatc
aacaccagtttcccgccccttctgcggcccacacgggatgtggacctcatcctgtcactg
gattacaacctccaaggagcctttcagcaactgcagctcctgggccggctctgccaggag
cagggcatccctttcccgcccatctcccccagcccagaggagcagcgccagcctccggag
tgctgcttgttttctgatccagaccgccctgatgccccagcggtgctgcacttccctctg
gtggatgcctccttccgggagtactcggcccctggcatccaacggacacctgaggagaag
ggggccggagaggtgaacctgtcttcatccaactctccctaccactactcgaaattaacc
tacagcccggaggacatggacaagctgctccacctgacacattacaacatctgcaacaac
caggagcagctgctggaggccctgcgtggagctgtgcaacggaagcgccggcagcaccgg
ccgtag

DBGET integrated database retrieval system