KEGG   Felis catus (domestic cat): 101082082
Entry
101082082         CDS       T02385                                 
Symbol
PSMD1
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 1
  KO
K03032  26S proteasome regulatory subunit N2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101082082 (PSMD1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101082082 (PSMD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082082 (PSMD1)
   05012 Parkinson disease
    101082082 (PSMD1)
   05014 Amyotrophic lateral sclerosis
    101082082 (PSMD1)
   05016 Huntington disease
    101082082 (PSMD1)
   05017 Spinocerebellar ataxia
    101082082 (PSMD1)
   05020 Prion disease
    101082082 (PSMD1)
   05022 Pathways of neurodegeneration - multiple diseases
    101082082 (PSMD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101082082 (PSMD1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101082082 (PSMD1)
SSDB
Motif
Pfam: RPN2_C PC_rep HEAT_2 Tim54
Other DBs
NCBI-GeneID: 101082082
NCBI-ProteinID: XP_011283930
Ensembl: ENSFCAG00000010085
UniProt: A0A337SSW7
LinkDB
Position
C1:214188677..214284680
AA seq 953 aa
MITSAAGIISLLDEEEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFA
ALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPE
GEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYS
LKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKED
NLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
EKPGSVLVGKTPEVSPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAV
RNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEAL
QLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLG
LGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQ
HEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIR
RLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICC
AGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDK
HDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLS
LAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAK
KKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRY
QPFKPLSIGGIIILKDTSEDTEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD
NT seq 2862 nt   +upstreamnt  +downstreamnt
atgatcacctcagctgctggaattatttctcttctggatgaggaagaaccacagcttaag
gaatttgcactacacaaattgaatgcagttgtcaatgatttctgggcagaaatttctgag
tctgtagataaaatagaagttttgtatgaagatgaaggtttccggagtcggcagtttgca
gccttagtggcatctaaagtattttatcaccttggggcttttgaggaatctctgaattat
gcacttggagctggtgacctcttcaatgtcaatgataactctgaatacgtggagactatt
atagcaaaatgcattgatcactacaccaaacaatgtgtggaaaatgcagatttgccagaa
ggagaaaaaaaaccaattgaccagagattagaaggaattgtaaataaaatgttccagcga
tgtctagatgatcacaagtataagcaagctattggcattgctctggagacacgaagactg
gacgtctttgagaagactatactggagtcgaatgatgtcccaggaatgctagcctatagc
ctcaagctctgcatgtctttaatgcagaataaacagtttcggaataaggtactaagggtt
ctagtgaaaatctacatgaatttggagaaacccgatttcatcaatgtttgtcagtgctta
attttcttagatgatcctcaggccgtgagtgatatcttagaaaaactggtcaaggaagac
aacctcctgatggcttatcagatttgttttgatttgtatgaaagtgctagccagcagttt
ttgtcatctgtaatccagaatcttcgaactgttggcacccctattgcttctgtgcctgga
tccaccaatacgggtactgtcccaggatcagagaaagacagtgactcaatggaaacagaa
gaaaagccaggtagtgtacttgtaggaaagacaccagaagtgagtccagagcccaaggac
cagactttgaaaatgattaaaattttaagcggtgaaatggctattgagttacatctacag
tttttaatacgaaataataacacagatctcatgattctaaaaaacacaaaggatgcagta
cggaattctgtatgtcacacagcaaccgttatagcaaattcttttatgcactgtgggact
accagtgaccagtttcttagagataacttggaatggttggccagagccactaactgggcg
aaatttacagctacagccagtttgggtgtaattcataagggtcacgagaaggaggcatta
cagttaatggcaacatatcttcccaaggacacttctccaggatccgcctatcaggaaggt
ggaggtctctatgcattaggtcttattcatgccaatcatggtggtgatataattgactat
ctgcttaaccagcttaagaatgctagcaatgatatcgttcgacatgggggcagcctgggc
ctgggtttggctgccatggggactgcacgccaggatgtatatgacttgctaaaaacgaac
ctttatcaggatgatgctgtgacaggggaagcagctggcctggccctaggtttggttatg
ttgggctctaaaaatgcccaggctattgaggacatggtcggctatgcacaggaaactcaa
catgagaagattctgcgtggtcttgcagttggcattgcattagtgatgtatgggaggatg
gaggaggctgatgctctcattgaatctctctgccgtgataaggacccaattcttcgacga
tctggaatgtacactgtagccatggcttattgtggctcgggtaacaacaaagctatccgg
cgcctgctacatgttgctgtaagtgacgttaatgatgatgtcaggagggcagcagtagaa
tcacttgggttcattcttttcaggacccctgaacagtgccccagcgttgtttcattgttg
tcagagagttacaatcctcacgtgcgttatggagctgctatggccctaggcatctgctgt
gctggtaccggaaacaaggaggcaattaatttgctagaaccgatgacaaatgatcctgtg
aactatgtgaggcaaggagctcttatagcttcagctctcatcatgatccagcagacggaa
atcacttgtccaaaggtgaatcagttcagacagctgtattccaaagttatcaatgataaa
catgatgatgtcatggccaagtttggcgctattttggcccagggcatactggatgcaggt
ggtcataatgtcacaatctccttgcagtccaggactgggcacacccatatgccttctgta
gttggcgtccttgtctttacccagttctggttctggtttcctctttcacacttcctgtca
ttggcttatacccctacctgtgtcattggccttaacaaggacttaaagatgccgaaagtt
cagtataaatcaaactgtaaaccatccacatttgcatatcctgcccctctggaagtacca
aaagaaaaagaaaaggaaaaggtttccactgctgtgttatctattactgccaaggctaaa
aaaaaggaaaaagaaaaagaaaaaaaagaggaggagaaaatggaagtggacgaagcagaa
aaaaaggaagaaaaagagaagaaaaaagaacctgagccaaacttccagttattggataac
ccagcccgagttatgcctgcccagcttaaggtcctgaccatgccagagacctgtagatac
cagcctttcaaaccactctccattggaggcatcataatcctgaaggataccagtgaagac
actgaagagctggtagaacctgtggcagcccacggcccaaaaattgaggaagaagaacaa
gagccagaacccccagagccatttgagtatatcgatgattaa

KEGG   Felis catus (domestic cat): 101082405
Entry
101082405         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: 26S proteasome regulatory subunit 4-like
  KO
K03062  26S proteasome regulatory subunit T2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101082405
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101082405
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101082405
   05165 Human papillomavirus infection
    101082405
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082405
   05012 Parkinson disease
    101082405
   05014 Amyotrophic lateral sclerosis
    101082405
   05016 Huntington disease
    101082405
   05017 Spinocerebellar ataxia
    101082405
   05020 Prion disease
    101082405
   05022 Pathways of neurodegeneration - multiple diseases
    101082405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101082405
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101082405
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 AAA_16 DivIC AAA_5 PhoH IstB_IS21 AAA_28 RNA_helicase RuvB_N TsaE ABC_tran AAA_7 Sigma54_activat AAA_18 IPT AAA_33 Mg_chelatase
Other DBs
NCBI-GeneID: 101082405
NCBI-ProteinID: XP_023110519
LinkDB
Position
B2:77850795..77852407
AA seq 435 aa
MGQSQSSGHGPGGVKKDDKDKRKKYKPPVPNRVPTKGTDAASKLPLVTPHTRCHLKLLKX
RIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMLVGTLEEIIDDNHTIVSTS
VGSEHYISILSFVDKDLLEPGCSVLLNRKVHAIIGVLMDDTDPLVMMMKVEKXPQETQAD
IGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPTGVILYGPTGTGKTLLAKAVANQTSAT
FPRVVGSELIQKYLGDRPKLVWELFRVAEEHGPFIVFIGEIDAIGTKRYDSNSSGEREIQ
RTMLELLNQLDGFDSRGDQKVIMAINQIETLDLALIRPGHIDRKNESPTKPDEKTEKCIF
QIHTSRMMLADDVTLDDLIMAKDDLSGADIKATCTEAGVMALREHRMKVTNEDFKKSKEN
VLYKKQEGTLEDLYL
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtagtggtcatggccctggaggtgtcaagaaggatgacaaggac
aagagaaagaagtacaaacctcctgtaccaaacagagtaccaaccaaagggactgatgct
gccagcaagctgccactggtgacacctcacactcggtgccacttaaaattactcaagntt
agaattaaagactatcttctcatggaggaagaattcattagaaatcaggaacaaatgaag
cctttagaagaaaagcaagaggaggaaagatcaaaggtggatgatctgagggggacccca
atgttggtaggaacgttggaagagatcattgatgacaatcataccatcgtgtccacatct
gtgggctcagaacactacatcagcattctttcctttgtagacaaggacctgctggagcca
ggctgttcagttctgctcaaccgcaaggtacatgccataataggggtgctcatggatgac
acggatcccttggtcatgatgatgaaagtagaaaagngcccccaggaaacccaagctgat
attggggggttggacaaccaaatccaggaaattaaggaatctgtggagcttcctctcact
catcctgaatattatgaagagatgggtataaagcccccaacaggggtcattctctatgga
ccaactggcacaggtaaaaccttattagccaaagcggtagcaaaccaaacctcagccact
ttcccaagagtggttggctctgaacttattcagaagtacctaggtgataggcccaaactc
gtttgggagttgtttcgagttgcagaagaacatgggccattcatcgtgtttattggtgaa
attgatgccattggaaccaaaagatatgattcaaattccagtggtgaaagagaaattcaa
cgaacaatgttggaactgttgaaccagttggatggatttgattcaaggggtgaccagaaa
gttatcatggccataaaccaaatagaaactttggatctagcacttatcagaccaggccac
attgacaggaaaaatgagtcccccaccaagcctgatgaaaagactgagaagtgcatcttt
cagatccacacaagcaggatgatgctggctgatgatgtgaccctggacgacttgatcatg
gctaaagatgacctctctggggccgacatcaaggcgacctgtacagaagctggtgtgatg
gccttgagagaacacagaatgaaagtaacaaatgaagactttaaaaaatccaaagaaaat
gttctttataaaaaacaagaaggcacccttgaagacctctacttgtag

KEGG   Felis catus (domestic cat): 101085106
Entry
101085106         CDS       T02385                                 
Symbol
PSMD6
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 6
  KO
K03037  26S proteasome regulatory subunit N7
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101085106 (PSMD6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101085106 (PSMD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085106 (PSMD6)
   05012 Parkinson disease
    101085106 (PSMD6)
   05014 Amyotrophic lateral sclerosis
    101085106 (PSMD6)
   05016 Huntington disease
    101085106 (PSMD6)
   05017 Spinocerebellar ataxia
    101085106 (PSMD6)
   05020 Prion disease
    101085106 (PSMD6)
   05022 Pathways of neurodegeneration - multiple diseases
    101085106 (PSMD6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101085106 (PSMD6)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101085106 (PSMD6)
SSDB
Motif
Pfam: RPN7 PCI
Other DBs
NCBI-GeneID: 101085106
NCBI-ProteinID: XP_003982446
Ensembl: ENSFCAG00000000573
LinkDB
Position
A2:complement(31526196..31541857)
AA seq 389 aa
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
LDWQMDTDLLSKMKKANEEELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccgctggagaacctcgaggaggagggtctgcccaagaaccccgacctgcgcatcgcg
cagctgcgtttcctgctcagcctgcccgagcaccgcggagacgcggccgtgcgcgacgag
ctgatggcggccgtccgggataataacatggctccttattacgaagccctgtgcaaatcc
ctcgactggcagatggatacagacctgctcagtaagatgaagaaggcgaatgaggaagag
ttgaaacgtttggacgaggagctggaagatgcagagaagaatctgggagagagcgaaatc
cgggatgccatgatggcgaaggccgagtacctgtgccggataggtgacaaggagggtgct
ctgacagcctttcgcaagacatatgacaaaaccgtggccttgggtcaccgactggatatt
gtgttttatcttcttaggattggcttattttatatggataatgatctcatcacacgaaac
acagagaaggccaaaagcttaatagaggaaggaggagattgggacaggagaaaccgccta
aaagtatatcaaggtctttactgtgtggctattcgtgatttcaaacaggcagctgaactc
ttccttgacacagtttcaacatttacatcctatgaacttatggattataaaacctttgtg
acttacactgtctatgtcagcatgattgccttagaaagacctgatctccgggaaaaggtg
attaaaggagcagagatcctggaggtgttgcacagccttccggcagttcggcagtatctg
ttttccctctatgaatgtcgttactcggttttcttccagtcattagctgttgtggaacag
gaaatgaaaaaggactggctttttgctcctcattatcgatactatgtaagagaaatgaga
attcatgcatacagccagctgctggaatcctataggtcattaactcttggctatatggca
gaagcctttggtgttggtgtggaattcattgatcaggaactctccagatttattgctgca
gggagactacactgcaaaatagataaagtaaatgaaatagtggaaaccaacagacctgat
agcaagaactggcagtaccaagaaactatcaagaaaggagatctgctgctaaacagagtt
cagaaactttccagagtaattaatatgtaa

KEGG   Felis catus (domestic cat): 101086215
Entry
101086215         CDS       T02385                                 
Symbol
PSMC2
Name
(RefSeq) 26S proteasome regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101086215 (PSMC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101086215 (PSMC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086215 (PSMC2)
   05012 Parkinson disease
    101086215 (PSMC2)
   05014 Amyotrophic lateral sclerosis
    101086215 (PSMC2)
   05016 Huntington disease
    101086215 (PSMC2)
   05017 Spinocerebellar ataxia
    101086215 (PSMC2)
   05020 Prion disease
    101086215 (PSMC2)
   05022 Pathways of neurodegeneration - multiple diseases
    101086215 (PSMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101086215 (PSMC2)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101086215 (PSMC2)
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 DUF815 AAA_2 RuvB_N AAA_33 AAA_7 AAA_28 AAA_18 Sigma54_activ_2 Mg_chelatase AAA_14 TIP49 AAA_24 RNA_helicase HMW1C_N T2SSE IstB_IS21
Other DBs
NCBI-GeneID: 101086215
NCBI-ProteinID: XP_003982735
Ensembl: ENSFCAG00000000638
UniProt: M3VV51
LinkDB
Position
A2:complement(82931577..82944675)
AA seq 433 aa
MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcctgattacctcggtgccgatcagcggaaaaccaaagaggatgagaaggacgacaag
cccatccgagctctggatgagggggatattgccttgctgaaaacttacggtcagagcact
tactctaggcagataaagcaggttgaagatgatattcaacaacttctcaagaagatcaat
gagcttactggtatcaaagaatctgatactggcctggccccaccagcactctgggatttg
gctgcagataagcaaacactgcagagtgaacagcctttgcaggttgcgaggtgtacaaag
atcatcaatgctgattcagaggacccaaagtacattatcaacgtgaagcagtttgccaag
tttgtggtggaccttagtgatcaggtggcacctactgacattgaagaagggatgagagtt
ggtgtggacagaaataagtatcagattcacattccgctgcctcccaagattgacccaaca
gttaccatgatgcaggtggaggaaaaacctgatgtcacatacagtgacgtgggtggctgt
aaagaacagattgagaaacttcgagaagtagttgaaaccccattacttcatccggagagg
tttgttaaccttggcattgagcctcccaagggtgtgctgctctttggcccaccgggtaca
ggcaagacactctgtgctcgggcagttgctaacaggacagatgcttgcttcattcgagtt
attggatctgaacttgtacagaagtacgttggtgagggggctcgaatggttcgggagctc
tttgaaatggccagaacaaaaaaagcctgccttatcttctttgatgaaattgatgctatt
ggaggggctcgttttgatgatggtgctggaggagacaacgaagtgcagagaacgatgctg
gaactgatcaatcaactggacggttttgatcctcgaggtaacattaaagtgctgatggcc
actaacagacctgacactttggatccagcactgatgaggccagggagattggacagaaag
attgaatttagcttacctgatctagagggtcggactcatatttttaagatccacgctcgc
tcaatgagcgtggaaagagatatcagatttgaactgttagcacgactgtgtccaaatagc
actggtgctgagattagaagtgtatgcacagaagctggtatgtttgctatcagagcacgg
cgaaaaattgctactgagaaagatttcctggaggctgtaaataaggtcattaagtcttat
gccaaattcagtgctactccccgctatatgacatacaactga

KEGG   Felis catus (domestic cat): 101086493
Entry
101086493         CDS       T02385                                 
Name
(RefSeq) LOW QUALITY PROTEIN: 26S proteasome complex subunit SEM1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca03440  Homologous recombination
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101086493
  09124 Replication and repair
   03440 Homologous recombination
    101086493
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101086493
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086493
   05012 Parkinson disease
    101086493
   05014 Amyotrophic lateral sclerosis
    101086493
   05016 Huntington disease
    101086493
   05017 Spinocerebellar ataxia
    101086493
   05020 Prion disease
    101086493
   05022 Pathways of neurodegeneration - multiple diseases
    101086493
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101086493
   04131 Membrane trafficking [BR:fca04131]
    101086493
   03051 Proteasome [BR:fca03051]
    101086493
   03400 DNA repair and recombination proteins [BR:fca03400]
    101086493
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     101086493
Membrane trafficking [BR:fca04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101086493
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101086493
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     101086493
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 101086493
NCBI-ProteinID: XP_019694746
LinkDB
Position
C1:160868367..160868589
AA seq 70 aa
MSEKKQLVDLGLWEEDNEFREFPKEDWAGLDENEEADVXENNWDFDNVEGNFSNLIXGKS
ETHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtcagagaaaaagcagctggtggacttaggtctctgggaggaggacaacgagttcagg
gagttccccaaggaagactgggctggtttagatgaaaatgaagaagcagatgtctaggaa
aataactgggattttgacaatgtagagggtaacttctccaatctgatatgaggtaaatca
gagacacatggttataagatggagacctcatag

KEGG   Felis catus (domestic cat): 101090224
Entry
101090224         CDS       T02385                                 
Symbol
PSMC4
Name
(RefSeq) 26S proteasome regulatory subunit 6B isoform X1
  KO
K03063  26S proteasome regulatory subunit T3
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101090224 (PSMC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101090224 (PSMC4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090224 (PSMC4)
   05012 Parkinson disease
    101090224 (PSMC4)
   05014 Amyotrophic lateral sclerosis
    101090224 (PSMC4)
   05016 Huntington disease
    101090224 (PSMC4)
   05017 Spinocerebellar ataxia
    101090224 (PSMC4)
   05020 Prion disease
    101090224 (PSMC4)
   05022 Pathways of neurodegeneration - multiple diseases
    101090224 (PSMC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101090224 (PSMC4)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101090224 (PSMC4)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_2 AAA_5 AAA_16 RuvB_N DUF815 AAA_22 RNA_helicase AAA_14 Mg_chelatase AAA_28 NTPase_1 AAA_18 AAA_33 Sigma54_activat NACHT TIP49 AAA_3 CENP-F_leu_zip IstB_IS21 AAA_7 TsaE ATPase_2 Zeta_toxin AAA_24 AAA_25 AAA_17 NB-ARC Parvo_NS1 DUF3450 ABC_tran AAA_30
Other DBs
NCBI-GeneID: 101090224
NCBI-ProteinID: XP_011288187
Ensembl: ENSFCAG00000001026
UniProt: M3VVV5
LinkDB
Position
E2:complement(14517601..14529831)
AA seq 418 aa
MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaggagataggcatcttggtagagaaagctcaggatgagatcccagcactgtctgtg
tctcggccccagactggcctttccttcctggggccggagcctgaggacctggaggacctg
tacagccgctacaagaagctgcagcaagagttggagttcctggaggtgcaggaggaatac
atcaaggatgagcagaagaacctgaagaaggaattcctccatgcccaggaggaggtgaag
cgaatccaaagcatcccactggtcattgggcagtttctggaggctgtggatcagaataca
gccattgtgggctccaccacaggctccaactactacgtgcgcatcctgagcaccattgat
cgggagctgctcaagcctaacgcctcggtggccctgcacaagcacagcaatgccctggtg
gacgtgctgcctcctgaggctgacagcagcatcatgatgctcacctcagaccagaagccg
gatgtgatgtatgcagacatcgggggcatggacatccagaagcaggaggtgcgggaggct
gtggagctcccacttacacacttcgagctgtataagcagatcggcatcgaccctccccga
ggcgtcctcatgtatggcccacctggctgcgggaagaccatgctggcgaaggctgtggct
catcacacgacagctgcgtttatccgggtcgtgggctccgagtttgtacagaaatacctg
ggcgagggcccccgcatggtccgggacgtgttccgcctggccaaggagaacgcacctgcc
atcatcttcatagatgagattgacgccattgccaccaagagatttgatgcccagacgggg
gctgacagggaggttcagagaatcctgctggagctgctgaatcaaatggacggatttgac
cagaacgttaacgtcaaggtgatcatggccacgaacagagcagacactctggatcctgcc
ctgctgcggccaggacgccttgatcgtaaaattgaatttccactccctgaccgccgccag
aagagattgattttctccactatcaccagcaagatgaatctctctgaggaggttgacttg
gaagactatgtggcccgaccagataagatttcaggagccgatatcaactccatctgtcag
gagagtggaatgttggctgtccgtgagaaccgctacattgttctggctaaggacttcgag
aaagcatacaagacagtcatcaagaaggatgaacaggagcatgagttttataagtga

KEGG   Felis catus (domestic cat): 101091665
Entry
101091665         CDS       T02385                                 
Symbol
PSMD11
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101091665 (PSMD11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101091665 (PSMD11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091665 (PSMD11)
   05012 Parkinson disease
    101091665 (PSMD11)
   05014 Amyotrophic lateral sclerosis
    101091665 (PSMD11)
   05016 Huntington disease
    101091665 (PSMD11)
   05017 Spinocerebellar ataxia
    101091665 (PSMD11)
   05020 Prion disease
    101091665 (PSMD11)
   05022 Pathways of neurodegeneration - multiple diseases
    101091665 (PSMD11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101091665 (PSMD11)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101091665 (PSMD11)
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 AAA_16
Other DBs
NCBI-GeneID: 101091665
NCBI-ProteinID: XP_023099204
Ensembl: ENSFCAG00000002060
LinkDB
Position
E1:20497196..20527270
AA seq 422 aa
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacattctccactccatcgtgaagcgtgacattcaggagaatgatgag
gaggcagtgcaggtcaaagagcagagtatcctggaactcgggtctctcttggcgaagact
ggacaagctgcagagcttggaggactcctgaagtatgtgcgacccttcttgaattccatc
agcaaggctaaggcagctcgtctggtccgatctcttcttgatctgtttcttgatatggaa
gcagctacagggcaggaggtcgagttgtgtttagagtgcatcgaatgggccaaatcagag
aaaagaactttcttacgccaagctttggaggcaagactggtgtctttgtactttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgctgcgggagttgaaaaagatg
gatgacaaagcccttttggtggaagtacagcttttagaaagcaaaacataccatgccctg
agcaacctgccgaaagcccgagctgccttaacctctgctcgaactacagcaaatgctatc
tactgcccccctaaattgcaggccacattggatatgcaatcaggtattatccatgcagca
gaggagaaggattggaaaactgcatactcatatttctatgaggcatttgagggttatgat
tccatcgatagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaattatg
ctcaacaccccagaagatgtccaggctttggtgagcgggaaacttgcgcttcggtatgca
gggaggcagacagaagcattaaaatgtgtggctcaggctagcaagaacagatcactggca
gattttgaaaaggccctgacagattaccgggcagagctccgggatgacccaatcatcagt
acacacttggccaagttgtatgacaacttgctggaacagaatctgatccgggtcattgag
cctttttcccgagttcagattgaacacatatctagcctcatcaaactctccaaggccgac
gtggaaaggaaattatcacagatgattcttgacaagaaatttcatgggatcttggaccag
ggggagggtgtcttgattattttcgatgaacccccagtagataaaacttatgaagctgct
ctggaaacaattcagaacatgagtaaagtagtggattccctctacaacaaagccaagaaa
ctgacatag

KEGG   Felis catus (domestic cat): 101094025
Entry
101094025         CDS       T02385                                 
Symbol
PSMC1
Name
(RefSeq) 26S proteasome regulatory subunit 4
  KO
K03062  26S proteasome regulatory subunit T2
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101094025 (PSMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101094025 (PSMC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101094025 (PSMC1)
   05165 Human papillomavirus infection
    101094025 (PSMC1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094025 (PSMC1)
   05012 Parkinson disease
    101094025 (PSMC1)
   05014 Amyotrophic lateral sclerosis
    101094025 (PSMC1)
   05016 Huntington disease
    101094025 (PSMC1)
   05017 Spinocerebellar ataxia
    101094025 (PSMC1)
   05020 Prion disease
    101094025 (PSMC1)
   05022 Pathways of neurodegeneration - multiple diseases
    101094025 (PSMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101094025 (PSMC1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101094025 (PSMC1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 AAA_18 AAA_25 AAA_33 ATPase IstB_IS21 AAA_28 RNA_helicase AAA_3 AAA_14 Mg_chelatase TIP49 AAA_7 Prot_ATP_OB_N NACHT PhoH AAA_24 AAA_30 NB-ARC ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 101094025
NCBI-ProteinID: XP_003987959
Ensembl: ENSFCAG00000011310
UniProt: A0A2I2UUT8
LinkDB
Position
B3:136031469..136045101
AA seq 440 aa
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KRRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgggtcaaagtcagagtggtggtcatggccctggaggtggcaagaaggatgacaaggat
aagaaaaagaagtacgaacctcctgtaccaaccagagtggggaaaaagaagaagaaaaca
aagggaccggatgctgccagcaagctgccactggtgacacctcacactcagtgccgctta
aaattactgaagttagagagaattaaagactatcttctcatggaggaagaattcattaga
aatcaggaacaaatgaagcctttagaagaaaagcaagaggaggagagatcaaaggtggat
gatctgagggggaccccgatgtcggtaggaacgttggaagagatcattgatgacaatcac
gccatcgtgtccacgtctgtgggctcagaacactacgtcagcattctctcctttgtagac
aaggacctgctggagccaggctgttcggtcctgctcaaccacaaggtacatgccgtcata
ggggtgctcatggatgacacggatcccttggtcacagtgatgaaagtagaaaaggccccc
caggaaacctatgctgatattggggggctggacaaccaaatccaggaaattaaggaatct
gtggagcttcctctcactcatcctgaatattatgaagagatgggtataaagcccccaaaa
ggggtcattctctatggaccacctggcacaggtaaaaccttattagccaaagcagtagca
aaccaaacctcagccactttcctaagagtggttggctctgaacttattcagaagtaccta
ggtgatgggcccaaactcgttcgggagttatttcgagttgcagaagaacacgcgccatcc
atcgtgtttattgatgaaattgatgccattggaacaaaaagatacgattcaaattccggt
ggtgaaagagaaatccagcgaacaatgttggaactgttgaaccagttggatggatttgat
tcaaggggtgacgtgaaagttatcatggccacaaaccgaatagaaactttggatccagca
cttatcagaccaggccgcattgacaggaaaattgagttccccctgcccgatgaaaagacc
aagaggcgcatctttcagatccacacaagcaggatgacgctggccgatgatgtgaccctg
gacgacttgatcatggctaaagatgacctctctggggccgacatcaaggcgatctgtaca
gaagctggtctgatggccttgagagaacgcagaatgaaagtaacaaatgaagacttcaaa
aaatcgaaagaaaacgttctttataaaaaacaagaaggtacccctgaagggctctacttg
tag

KEGG   Felis catus (domestic cat): 101094305
Entry
101094305         CDS       T02385                                 
Symbol
PSMD3
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 3 isoform X2
  KO
K03033  26S proteasome regulatory subunit N3
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101094305 (PSMD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101094305 (PSMD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094305 (PSMD3)
   05012 Parkinson disease
    101094305 (PSMD3)
   05014 Amyotrophic lateral sclerosis
    101094305 (PSMD3)
   05016 Huntington disease
    101094305 (PSMD3)
   05017 Spinocerebellar ataxia
    101094305 (PSMD3)
   05020 Prion disease
    101094305 (PSMD3)
   05022 Pathways of neurodegeneration - multiple diseases
    101094305 (PSMD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101094305 (PSMD3)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101094305 (PSMD3)
SSDB
Motif
Pfam: Rpn3_C PCI TPR_2 CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 101094305
NCBI-ProteinID: XP_003996842
Ensembl: ENSFCAG00000014991
UniProt: M3WLR0
LinkDB
Position
E1:41012225..41027037
AA seq 532 aa
MKQEGSGRRRGADKAKPPPGGGEQEPPPPPTPQDVEMKEEAAAGGASAGEADSKTAAAEH
SQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVHGFFT
SNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASAPLLPEVEAYLQLLVVIFLMNSKRYK
EAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRH
DADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEY
SEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFL
LTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADI
AQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISF
CLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgaaacaggagggctcggggcgccgccgcggcgcggacaaggcaaagccgccgccgggc
ggaggggagcaagaaccaccgccgcccccgactccccaggatgtggagatgaaagaggag
gcggcggcgggtggcgcgtcagcgggagaagctgacagcaaaacggcggcggctgagcac
tcccagcgagagctggacaccgtcaccttggaggacattaaagagcatgtgaaacagctg
gagaaggcagtttcgggcaaggagcctcgatttgtgctgagggccctgcggatgctccct
tccacatcacgtcgcctcaaccactacgttctgtataaggctgtacatggcttcttcacc
tcaaataatgccactcgagacttcttgctacccttcctggaagagcccatggacaccgaa
gctgatttacagttccgtccccgaacaggaaaagctgcatcggcacccctcctgcctgag
gtggaagcctatctacagctcctcgtggtcatcttcctgatgaacagcaaacgctacaaa
gaggcacagaagatctctgatgacctaatgcagaagatcagcactcagaaccgccgggcc
ctggaccttgtggccgcaaagtgttactactatcatgcccgggtctatgagttcctggac
aagctggatgtggtgcgcagcttcttgcatgctcggctccggacagccacccttcggcat
gatgcggatgggcaggccaccctgctgaacctcctgctgcggaactacctacactacagc
ttgtacgaccaggctgagaagctggtgtccaagtccgtgttccccgagcaggccaacaac
aatgagtgggccaggtacctctactacacagggcgaatcaaagctattcagttggagtac
tcagaggcccggagaacaatgaccaatgcccttcgcaaggcccctcagcacacagctgtc
ggcttcaaacagacggtgcacaagcttctgattgtggtggagctgctgcttggggagatc
ccagaccggctacagttccgtcagccatctctcaagcgctcgctcatgccctacttcctt
cttactcaagctgtcaggaccggaaaccttgccaagttcaaccaggtcctggaccagttt
ggagagaagtttcaagcagatgggacctataccctaatcatccgactacggcacaacgtc
attaagacaggtgtgcgcatgatcagcctttcctattcccgaatctccctggctgacatc
gcccagaagctgcagctggatagcccagaggatgcagagttcattgttgccaaggccatc
cgggatggtgtcattgaggccagcatcaaccacgagaagggctacgtccagtccaaggag
atgattgatatctactccacccgtgagccccagctggccttccaccagcgcatctccttc
tgtctagatatccacaacatgtccgtcaaggccatgaggtttcctcccaaatcgtacaac
aaggacttggagtctgcagaggaacggcgcgagcgagagcagcaggacttggagtttgcc
aaggagatggccgaagatgatgatgacagcttcccttga

KEGG   Felis catus (domestic cat): 101094744
Entry
101094744         CDS       T02385                                 
Symbol
SEM1
Name
(RefSeq) 26S proteasome complex subunit SEM1
  KO
K10881  26 proteasome complex subunit DSS1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca03440  Homologous recombination
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101094744 (SEM1)
  09124 Replication and repair
   03440 Homologous recombination
    101094744 (SEM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101094744 (SEM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094744 (SEM1)
   05012 Parkinson disease
    101094744 (SEM1)
   05014 Amyotrophic lateral sclerosis
    101094744 (SEM1)
   05016 Huntington disease
    101094744 (SEM1)
   05017 Spinocerebellar ataxia
    101094744 (SEM1)
   05020 Prion disease
    101094744 (SEM1)
   05022 Pathways of neurodegeneration - multiple diseases
    101094744 (SEM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101094744 (SEM1)
   04131 Membrane trafficking [BR:fca04131]
    101094744 (SEM1)
   03051 Proteasome [BR:fca03051]
    101094744 (SEM1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101094744 (SEM1)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     101094744 (SEM1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    101094744 (SEM1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101094744 (SEM1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     101094744 (SEM1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 101094744
NCBI-ProteinID: XP_023106137
Ensembl: ENSFCAG00000023254
LinkDB
Position
A2:complement(101428521..101452925)
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtcagagaaaaagcagccagtagatttgggtctcttggaggaggacgacgagttcgag
gagttccctgcggaagactgggctggtttggatgaggatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttctccaatcagttacgagctgaacta
gagaaacatggttataagatggagacttcatag

KEGG   Felis catus (domestic cat): 101095118
Entry
101095118         CDS       T02385                                 
Symbol
PSMD14
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 14
  KO
K03030  26S proteasome regulatory subunit N11
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101095118 (PSMD14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101095118 (PSMD14)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095118 (PSMD14)
   05012 Parkinson disease
    101095118 (PSMD14)
   05014 Amyotrophic lateral sclerosis
    101095118 (PSMD14)
   05016 Huntington disease
    101095118 (PSMD14)
   05017 Spinocerebellar ataxia
    101095118 (PSMD14)
   05020 Prion disease
    101095118 (PSMD14)
   05022 Pathways of neurodegeneration - multiple diseases
    101095118 (PSMD14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101095118 (PSMD14)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101095118 (PSMD14)
   03051 Proteasome [BR:fca03051]
    101095118 (PSMD14)
Peptidases and inhibitors [BR:fca01002]
 Metallo peptidases
  Family M67
   101095118 (PSMD14)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    101095118 (PSMD14)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101095118 (PSMD14)
SSDB
Motif
Pfam: JAB MitMem_reg Prok-JAB DUF4525
Other DBs
NCBI-GeneID: 101095118
NCBI-ProteinID: XP_006935378
Ensembl: ENSFCAG00000030865
UniProt: A0A337S6G5
LinkDB
Position
C1:153254771..153351676
AA seq 310 aa
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt   +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacccaca
gatgctcctgcagtggacacagcagagcaagtatatatttcttcccttgcactgttaaaa
atgttaaagcatggtcgtgctggagttccaatggaagttatgggtcttatgcttggagaa
tttgttgatgattacaccgtcagagtgattgatgtgtttgctatgccacagtcaggaaca
ggtgtcagtgtggaggcagttgatccagtgttccaagccaaaatgttagatatgttgaag
cagacaggaaggcctgagatggttgttggttggtatcacagtcaccctggctttggttgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttatcgatgccttc
agattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacctcaaat
ctgggtcatttaaacaagccatctatccaggcgttaattcacggactaaacagacactac
tactccattactattaactaccgaaaaaatgaactggaacagaagatgttgctaaatttg
cataagaagagttggatggaaggtttgacacttcaggactacagtgaacactgtaaacac
aatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggacccc
aaacgtcatttggaggaacatgtggatgtacttatgacttcaaatatcgtccagtgttta
gcagctatgttggatactgtcgtatttaaataa

KEGG   Felis catus (domestic cat): 101095190
Entry
101095190         CDS       T02385                                 
Symbol
PSMD2
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101095190 (PSMD2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101095190 (PSMD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095190 (PSMD2)
   05012 Parkinson disease
    101095190 (PSMD2)
   05014 Amyotrophic lateral sclerosis
    101095190 (PSMD2)
   05016 Huntington disease
    101095190 (PSMD2)
   05017 Spinocerebellar ataxia
    101095190 (PSMD2)
   05020 Prion disease
    101095190 (PSMD2)
   05022 Pathways of neurodegeneration - multiple diseases
    101095190 (PSMD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101095190 (PSMD2)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101095190 (PSMD2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep THAP
Other DBs
NCBI-GeneID: 101095190
NCBI-ProteinID: XP_006936288
Ensembl: ENSFCAG00000007793
UniProt: M3W8D9
LinkDB
Position
C2:complement(85245906..85255070)
AA seq 908 aa
MEEGGRDKAPLQPQQPPATAPGIADEKPGGKERRDAGDKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMPPGENKR
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKTQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggtggccgggataaggctccgctgcagcctcagcagcctccggcgacggca
ccgggcatcgcggacgagaagccgggcggcaaggagcggcgggatgctggcgacaaggac
aaagagcaggagctgtctgaggaggacaaacaacttcaggatgaactggagatgctcgtg
gaacgactgggggagaaggacacatctctgtaccgaccagccctcgaggaactgcggagg
caaatccgatcttctacaacttccatgacttcagtgcccaagcctctcaaatttctgcgt
ccacactatggcaaactgaaggaaatctatgagaacatgccccctggggagaataagcgt
tttgctgctgacatcatctctgttctggctatgaccatgagtggggaacgtgagtgtctc
aagtatcggctggtgggctcccaagaggaattggcatcatggggtcatgagtatgtgagg
catctcgcaggggaagtggctaaggagtggcaggaactagatgacgcggaaaagacacaa
cgggagccactgctgaccctggtgaaggagatcgtcccctacaacatggcccacaacgcg
gagcacgaggcctgtgacctgctcatggaaattgagcaggtagacatgctggagaaggac
attgatgagaatgcatatgccaaggtctgcctctatcttaccagctgtgtgaattatgtg
cccgagcctgagaattctgcactactgcgctgtgctttgggtgtgttccgaaagttcagt
cgttttcctgaagctctgagattggcattgatgctcaatgacatggagctggtagaagat
atcttcacctcctgcaaggacgtggtagtacagaagcagatggcattcatgcttggccgt
catggggtgtttctggagcttagtgaagacgtggaggagtatgaggacctgacagagatc
atgtccaatgtgcagctcaacagcaacttcttggcattagctcgggagctggatattatg
gagcccaaggtgcctgatgacatctataaaacccatctagagaacaacagatttgggggc
agtggctctcaagtggactctgcccgcatgaacctggcctcttcttttgtgaatggcttt
gtgaatgcagcctttggtcaggacaagctgctgactgatgatggcaacaaatggctttac
aagaacaaagaccatggaatgttgagtgcagctgcgtcccttggcatgattctgctgtgg
gatgtggatggtggcctcacgcagattgacaagtacttgtactcctctgaggactacatc
aagtcaggagcccttctggcctgtggcattgtgaactctggagtccggaatgaatgtgac
cccgcactagcactgctctcagactatgttctccacaacagcaacactatgagacttggt
tccatttttgggctaggcttggcttacgctggctccaatcgtgaagatgtgctaacactg
ctgctccctgtgatgggagattccaagtctagtatggaggtggcaggtgtgacagctcta
gcctgtggaatgatagcagtgggatcctgcaatggagatgttacttccactatccttcag
accatcatggagaaatcagagactgagctcaaggacacctatgcccgttggcttcctctt
ggactgggcctcaaccacttggggaagggtgaggccatcgaggcaatcctggctgcgctg
gaggttgtgtcagagccattccgcagttttgccaacacattagtggatgtgtgtgcctat
gcaggctctgggaatgtactgaaggtgcagcagctgctccacatttgtagtgaacacttt
gactccaaggaaaaagaggaagacaaggacaagaaggaaaagaaggacaaggacaagaag
gaagcccctgccgacatgggagcacatcagggagtggctgtgctggggattgcccttatt
gctatgggggaggagattggagcagagatggcattacgaaccttcggccacctgctgaga
tatggggagccaacactccgacgggctgtgcctttagcactggctctaatctctgtttca
aatccacgactcaacatcctggataccctaagcaaattctcccatgatgctgacccagaa
gtttcctacaactccatttttgccatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgctgcgccagttagcccagtatcatgccaaggaccccaacaacctcttt
atggtgcgcttggcacagggcctgacacatttagggaagggcacactcaccctctgtccc
taccacagtgaccggcagcttatgagtcaagtggcagtggcggggctgcttactgtgctt
gtctctttcctggatgtccgtaacatcatcctaggcaaatcacattatgtattgtatggg
ctggtggctgccatgcagccccgaatgctggttacattcgatgaggagctgcggccactg
ccggtgtcggtccgtgtgggccaggcagtggatgtggtgggccaggctggcaagcctaag
actatcacagggttccagacacacacaaccccagtattgttggcccacggggagcgggca
gaattggccactgaggaatttcttcctgtcacccccattctggaaggttttgttatcctt
cggaagaaccccaactatgacctctaa

KEGG   Felis catus (domestic cat): 101095435
Entry
101095435         CDS       T02385                                 
Symbol
PSMC3
Name
(RefSeq) 26S proteasome regulatory subunit 6A
  KO
K03065  26S proteasome regulatory subunit T5
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101095435 (PSMC3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101095435 (PSMC3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095435 (PSMC3)
   05012 Parkinson disease
    101095435 (PSMC3)
   05014 Amyotrophic lateral sclerosis
    101095435 (PSMC3)
   05016 Huntington disease
    101095435 (PSMC3)
   05017 Spinocerebellar ataxia
    101095435 (PSMC3)
   05020 Prion disease
    101095435 (PSMC3)
   05022 Pathways of neurodegeneration - multiple diseases
    101095435 (PSMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101095435 (PSMC3)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101095435 (PSMC3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 Mg_chelatase AAA_11 DUF815 PhoH Sigma54_activat DUF5827 IstB_IS21 AAA_24 ATPase AAA_7 DUF3713 RNA_helicase
Other DBs
NCBI-GeneID: 101095435
NCBI-ProteinID: XP_003993291
UniProt: A0A337SBG2
LinkDB
Position
D1:complement(101393545..101399661)
AA seq 439 aa
MNLLPELESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaatctgctgccggaactggagagtccagtgactcggcaggagaagatggctaccgtg
tgggatgaagctgagcaagatggaatcggggaggaggtgctcaagatgtccacagaagag
attatccagcgcacacggctgctggacagtgagatcaagatcatgaagagtgaagtattg
cgagttacccacgaactccaggccatgaaggacaagatcaaagagaacagtgagaaaatc
aaagtgaacaagaccctgccgtaccttgtctccaacgtcatcgagcttctagatgttgat
cccaatgaccaagaggaggatggtgccaatattgacctggattcccagaggaagggtaaa
tgtgcagtgatcaaaacctctacccgacagacatacttcctgcctgtgattgggttggtg
gatgctgaaaagctaaagcccggagacttggtgggtgtgaacaaagactcctatctgatc
ctggagaccctgcctacagagtatgactcacgggtgaaggccatggaggtggatgagagg
cccacagaacaatacagtgacattgggggcctggacaaacagattcaggagctggtggag
gccattgtcctgccaatgaaccacaaggagaagtttgagaacttggggatccagcctcca
aaaggggtgttgatgtatggacctccaggtacggggaagaccctgctggcccgggcctgt
gctgcacagaccaaggctaccttcctgaagctggctggcccacagctggtgcagatgttc
attggggatggtgccaagctggtccgcgatgcctttgccctggctaaggagaaagctcca
tccattatcttcattgatgagctggatgccatcggcactaagcgctttgacagtgagaag
gctggagaccgggaggtacagaggacaatgttggagcttctgaaccaactggacgggttc
cagcccaacactcaagtaaaggtaattgcagccaccaacagggtggacatcttggacccc
gcacttctccgctcaggccgtctggaccgaaagattgaatttccgatgcccaacgaggag
gcccgggccagaatcatgcagatccactcccgcaagatgaacgtcagtcctgacgtcaac
tatgaggagctggcccgctgtacggatgacttcaatggggcccagtgcaaggccgtgtgt
gtggaggcgggcatgatcgcgctgcgcaggggcgccacagagctcacccacgaggactac
atggagggcatcctggaggtgcaggccaagaagaaagccaacctgcagtactacgcctag

KEGG   Felis catus (domestic cat): 101095457
Entry
101095457         CDS       T02385                                 
Symbol
PSMD8
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 8
  KO
K03031  26S proteasome regulatory subunit N12
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101095457 (PSMD8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101095457 (PSMD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095457 (PSMD8)
   05012 Parkinson disease
    101095457 (PSMD8)
   05014 Amyotrophic lateral sclerosis
    101095457 (PSMD8)
   05016 Huntington disease
    101095457 (PSMD8)
   05017 Spinocerebellar ataxia
    101095457 (PSMD8)
   05020 Prion disease
    101095457 (PSMD8)
   05022 Pathways of neurodegeneration - multiple diseases
    101095457 (PSMD8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101095457 (PSMD8)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101095457 (PSMD8)
SSDB
Motif
Pfam: CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 101095457
NCBI-ProteinID: XP_011288167
LinkDB
Position
E2:complement(15573870..15581270)
AA seq 351 aa
MFIKGRAPRAPPRERLNANRGVAGPAAVAPPPALGSTFRPHFRRARGFRRRCRKSGRRFA
ASRKMAAAAVNGSPGASGSGPAAASGAVLQVAAGMYEQLKGEWNRKSPNLSKCGEELGRL
KLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYK
EQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEG
SYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKM
TDYAKKRGWVLGLNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttcattaagggccgggctccaagggcaccgccccgagagcgactgaacgctaaccgc
ggcgtggcggggccggcagccgtagccccgcccccggctctgggctccacctttcggccc
cacttccgccgggcgagaggctttaggcgtcgctgccgtaagtcggggaggaggtttgcc
gcatcacggaagatggcggccgcggcggtgaacgggtcgcccggcgcctctggctcaggg
cctgcggcggcctcgggcgcagtcctgcaggtcgcggccggcatgtacgagcaacttaag
ggcgagtggaaccgcaaaagccccaatcttagcaagtgcggtgaagagctgggccgtctc
aagctggttctgctggagctcaacttcttgccaaccacagggaccaaactgaccaaacag
cagctcattctggcccgtgacattctggagattggggcccagtggagcatcctgcgcaag
gacatcccttccttcgaacgctacatggcccagctcaaatgctactactttgattacaag
gagcagctccccgagtcagcctacatgcaccagctcttgggcctcaacctcctcttcctg
ctgtcccagaaccgggtggctgagttccacacggagttggagaggctgcctgccaaggac
atccaaaccaatgtgtacatcaagcatcctgtgtccctggagcagtacctgatggagggc
agctataacaaggtgttcctggccaaaggcaacatccctgctgagagctacactttcttc
attgacatcctgcttgacactatcagggatgagattgctgggtgcatcgagaaggcctat
gagaaaatccttttcactgaggccacccggatcctcttcttcaacacacccaaaaagatg
acggactacgccaagaagcgagggtgggttctgggcctcaacaactactacagttttgcc
agccagcagcagaagccagaagataccaccatcccctccacggaactggccaaacaggtc
atcgagtatgcccggcagctggagatgatcgtctga

KEGG   Felis catus (domestic cat): 101097227
Entry
101097227         CDS       T02385                                 
Symbol
ADRM1
Name
(RefSeq) proteasomal ubiquitin receptor ADRM1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101097227 (ADRM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101097227 (ADRM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097227 (ADRM1)
   05012 Parkinson disease
    101097227 (ADRM1)
   05014 Amyotrophic lateral sclerosis
    101097227 (ADRM1)
   05016 Huntington disease
    101097227 (ADRM1)
   05017 Spinocerebellar ataxia
    101097227 (ADRM1)
   05020 Prion disease
    101097227 (ADRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    101097227 (ADRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101097227 (ADRM1)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101097227 (ADRM1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD
Other DBs
NCBI-GeneID: 101097227
NCBI-ProteinID: XP_023106803
Ensembl: ENSFCAG00000003252
LinkDB
Position
A3:complement(1882691..1888982)
AA seq 406 aa
MTTSGALFPSLVPGSRGSSNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSGGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSGGPPASSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASVT
SPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTAEEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNSARSEQEGDGKDKKDEEEDMSLD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgacgacttcaggcgctctgtttccaagcctggtgccaggctcccgaggctcctccaac
aagtatctggtggagtttcgtgcaggaaagatgtcgctaaaaggaactactgtcacccca
gataaacggaaagggctcgtgtacattcagcagacggatgactccctcattcacttctgc
tggaaggacaggacatctgggaacgtggaggacgatttgatcatctttcctgacgactgt
gagttcaagcgcgtgccgcagtgccccagcgggagggtctacgtgctcaagtttaaggca
gggtccaagcggctcttcttctggatgcaggagcccaagacggaccaggacgaggagcac
tgccgcaaggtcaacgagtatctgaacaaccccccgatgcctggagcgctgggggcgagt
gggagtggaggccacgagctctctgcactgggcggcgagggcggcctgcagagtctgctg
gggaacatgagccacagccagctcatgcagctcatcggacccgccggccttggaggactg
gggggactgggggccctgaccgggccgggcctggccagcttactggggagtggagggcct
ccggcgagcagctcttcgtccagctcgcggagccagtcggcagcagtcaccccgtcctcc
accacctcttctacccgagccacccccgccccttccgctccagcagctgcctcggtgacc
agtcccagccccgcacccagttcaggtaatggaaccagcacggcagccagcccaacccag
cccatccagctgagcgaccttcagagcattctagctactatgaacgtgccggcagggcca
ggaggcggccagcaagttgacctggccagtgttctgacgcccgagatcatggcccctatc
ctcgccaacgcggacgtccaggagcgcctcttgccctacctgccctctggggagtcactg
ccacagacggcagaggagatccagaacacgctgacctcgccccagttccagcaggccctg
ggcatgttcagtgcagccctggcctctgggcagctgggccccctcatgtgccagtttggc
ctgcctgcagaggccgtggaggcggccaacaaaggcgatgtggaagcatttgccaaagcc
atgcagaacagtgccagatccgagcaggagggcgacgggaaggacaagaaggacgaagag
gaggacatgagcttagattaa

KEGG   Felis catus (domestic cat): 101097360
Entry
101097360         CDS       T02385                                 
Symbol
PSMC5
Name
(RefSeq) 26S proteasome regulatory subunit 8 isoform X2
  KO
K03066  26S proteasome regulatory subunit T6
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101097360 (PSMC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101097360 (PSMC5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097360 (PSMC5)
   05012 Parkinson disease
    101097360 (PSMC5)
   05014 Amyotrophic lateral sclerosis
    101097360 (PSMC5)
   05016 Huntington disease
    101097360 (PSMC5)
   05017 Spinocerebellar ataxia
    101097360 (PSMC5)
   05020 Prion disease
    101097360 (PSMC5)
   05022 Pathways of neurodegeneration - multiple diseases
    101097360 (PSMC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101097360 (PSMC5)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101097360 (PSMC5)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_5 AAA_16 AAA_22 RuvB_N TIP49 AAA_33 AAA_18 AAA_3 Mg_chelatase ATPase FapA PhoH IstB_IS21 AAA_28 AAA_24 AAA_14 Sigma54_activat AAA_7 AAA_17 DUF815 bpMoxR AAA_25 Parvo_NS1 Zeta_toxin RNA_helicase HR1 TsaE AAA_19 AAA_11
Other DBs
NCBI-GeneID: 101097360
NCBI-ProteinID: XP_003997107
Ensembl: ENSFCAG00000003501
UniProt: M3W0G3
LinkDB
Position
E1:48100687..48105079
AA seq 406 aa
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcgcttgacggaccggagcagatggagctggaagagggaaaagcaggcagtggactc
cgccagtattatctgtccaagattgaagaattgcagctgattgtgaatgacaagagccag
aatctccggaggctgcaggcacagaggaatgagctcaatgcgaaagttcgcctactgcgg
gaagagctacagctgctccaggaacagggctcctatgtaggagaagtagtccgggccatg
gataagaagaaagtgttggttaaggtgcatcccgaaggcaagtttgtcgtagatgtggac
aagaacatcgacatcaacgatgtgacacccaattgccgagtggctctaagaaacgacagc
tacactctgcacaagatattgcccaacaaggtggaccccctggtgtcactgatgatggtg
gagaaagtgccagattcaacctatgagatgatcggtggactggacaagcagataaaggag
atcaaagaagtgatcgagctgcctgtcaagcatcctgagctctttgaagcgctgggcatt
gcacagcccaagggggtgctgctatatgggcccccaggcactgggaagacactgttggcc
cgggctgtggctcatcatacagactgtacctttattcgtgtctctggctctgaattggta
cagaaattcatcggggaaggggcaagaatggtgagggagctgtttgtcatggcacgagaa
catgctccttctatcatcttcatggatgaaatcgactccattggctcctcacggctggag
gggggttccggaggggacagtgaggtgcagcgcacaatgctggagctgctcaaccagctg
gatggctttgaggccaccaagaatatcaaggttatcatggctactaacaggattgacatc
ctggactcggcgctgctccgccctgggcgcatcgacaggaaaattgaattcccacccccc
aatgaggaggcccggctggacattttgaagattcattctcggaaaatgaacctgacccgg
gggatcaacctgcggaagattgctgagctcatgcctggagcgtcaggggctgaagtaaag
ggcgtgtgcaccgaagccggcatgtatgccctgcgggagcggcgagtccacgtcacgcag
gaggactttgagatggcagtggccaaggtcatgcagaaggacagcgagaagaacatgtct
atcaagaagctatggaagtga

KEGG   Felis catus (domestic cat): 101098564
Entry
101098564         CDS       T02385                                 
Symbol
PSMD4
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 4 isoform X2
  KO
K03029  26S proteasome regulatory subunit N10
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101098564 (PSMD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098564 (PSMD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101098564 (PSMD4)
   05012 Parkinson disease
    101098564 (PSMD4)
   05014 Amyotrophic lateral sclerosis
    101098564 (PSMD4)
   05016 Huntington disease
    101098564 (PSMD4)
   05017 Spinocerebellar ataxia
    101098564 (PSMD4)
   05020 Prion disease
    101098564 (PSMD4)
   05022 Pathways of neurodegeneration - multiple diseases
    101098564 (PSMD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101098564 (PSMD4)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101098564 (PSMD4)
SSDB
Motif
Pfam: VWA_2 VWA Ssl1 UIM RAP80_UIM
Other DBs
NCBI-GeneID: 101098564
NCBI-ProteinID: XP_011283441
Ensembl: ENSFCAG00000005564
UniProt: A0A2I2V018
LinkDB
Position
C1:106332194..106341233
AA seq 377 aa
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATAGAEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
GQAESADIDASSAMDTSEPAKEEEDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
SQANKDGKKDKKEEDKK
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggtgttggaaagcactatggtctgtgtggacaacagtgaatatatgcggaatggggac
ttcttacccacccggctgcaggcccagcaggacgctgtcaacatagtgtgtcactccaag
acccgcagcaaccctgagaacaacgtgggcctcatcacactggccaatgactgtgaagtg
ctgaccaccctcacccctgacaccggccgcatcctttccaagcttcacactgtccaaccc
aagggcaagatcaccttctgcactggcatccgcgtggcccacctggcgttgaagcaccga
cagggcaagaatcacaagatgcgcatcattgcctttgtgggaagtccagtggaggacaat
gagaaggatctggtgaagctggctaaacgtctcaagaaggaaaaagtgaatgttgacatt
atcaactttggggaagaggaagtgaacacagaaaagctgacagcgtttgtaaacacactg
aatggcaaagatggtaccggttctcatctggtgacagtgccccccgggcccagcttggcc
gatgccctcatcagttctccgattctggctggtgaaggtggtgccatgctgggacttggt
gccagtgactttgaatttggagtggatcccagtgctgatcctgagctggccctggccctc
cgtgtctctatggaagagcagcggcagcggcaggaggaggaggcccggcgggcagctgca
gcctctgctgctgaggctgggattgctacagccggggccgaagactcggatgatgccctg
ctgaagatgaccatcagccagcaggagtttggccgcaccgggctccccgacctgagcagt
atgaccgaggaagagcagattgcctacgccatgcagatgtccctacagggtgcagagttt
ggccaggcagaatcagccgacattgatgccagttcagccatggacacatctgagcccgcc
aaggaggaggaggattatgatgtgatgcaggaccccgagttccttcagagtgtcctggag
aacctgccaggagtggatcccaacaatgaagctattcgaaatgccatggggtccctcgcc
tcccaggccaacaaggatggcaagaaagacaagaaggaggaggacaagaaatga

KEGG   Felis catus (domestic cat): 101098797
Entry
101098797         CDS       T02385                                 
Symbol
PSMC6
Name
(RefSeq) 26S proteasome regulatory subunit 10B
  KO
K03064  26S proteasome regulatory subunit T4
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101098797 (PSMC6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098797 (PSMC6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101098797 (PSMC6)
   05012 Parkinson disease
    101098797 (PSMC6)
   05014 Amyotrophic lateral sclerosis
    101098797 (PSMC6)
   05016 Huntington disease
    101098797 (PSMC6)
   05017 Spinocerebellar ataxia
    101098797 (PSMC6)
   05020 Prion disease
    101098797 (PSMC6)
   05022 Pathways of neurodegeneration - multiple diseases
    101098797 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101098797 (PSMC6)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     101098797 (PSMC6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_22 AAA_2 RuvB_N AAA_33 AAA_18 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 DUF5906 AAA_3 TPR_MLP1_2 RNA_helicase TIP49 bpMoxR Mg_chelatase AAA_11 Wtap TsaE AAA_24 AAA_25 ATPase NACHT AAA_19 AAA_28 IstB_IS21 Med4 DUF4140
Other DBs
NCBI-GeneID: 101098797
NCBI-ProteinID: XP_003987690
Ensembl: ENSFCAG00000012975
UniProt: M3WNQ7
LinkDB
Position
B3:102543627..102566461
AA seq 403 aa
MAIPGIPYERRLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSEND
LKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLT
IMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIP
PKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQ
PCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLD
PALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNV
CTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccattcccggcatcccctatgagcgacggcttctcatcatggcggaccctagagat
aaggcgcttcaggactaccgcaagaagctgctggagcacaaggagatcgacggccgtctc
aaggagttaagggaacaattaaaagaacttaccaagcagtatgaaaagtctgaaaatgat
ctgaaggccctacaaagtgttgggcagattgtaggtgaagtacttaagcaactaactgaa
gaaaaattcattgttaaagccacaaatggaccacgatatgttgtgggttgtcgtcgacag
cttgacaaaagtaagctgaagccaggaacaagagttgctttggatatgactacactaact
atcatgagatatttgccaagagaggtggatccactggtctacaacatgtctcatgaggac
cctgggaatgtttcttattctgagattggaggactatcagaacagattcgggaattgaga
gaggtgatagaattacctcttacaaacccagaattattccagcgtgtgggaataatacct
ccaaaaggctgtttgttatatggaccaccaggtacaggaaaaacacttttggcaagagct
gttgctagccagctggactgcaatttcttaaaggttgtatctagttctattgtagacaag
tacattggtgaaagtgctcgtttgatcagagaaatgtttaattatgccagggatcatcaa
ccatgcatcatttttatggatgaaatagatgctattggtggtcgtcggttttctgagggt
acttcagctgatagagagattcagagaactttaatggagttactcaatcaaatggatgga
tttgatactctacatagagttaaaatgatcatggctacaaacagaccggatacactggat
cctgctttgcttcgtccaggaagattagatagaaaaatacatattgatttaccaaatgag
caagcaagattagatatattgaaaatccatgcaggtcccattacaaagcatggtgaaata
gattatgaagcaattgtgaagctttcagatggctttaatggagcagacctgagaaatgtt
tgtactgaagcaggtatgtttgcaattcgtgctgatcatgattttgtagtacaggaagac
ttcatgaaagcagtcagaaaagtggctgattctaagaagctagagtctaaattggactac
aaacctgtgtaa

KEGG   Felis catus (domestic cat): 101098912
Entry
101098912         CDS       T02385                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101098912 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098912 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101098912 (PSMD7)
   05012 Parkinson disease
    101098912 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    101098912 (PSMD7)
   05016 Huntington disease
    101098912 (PSMD7)
   05017 Spinocerebellar ataxia
    101098912 (PSMD7)
   05020 Prion disease
    101098912 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    101098912 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101098912 (PSMD7)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101098912 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N RPA43_OB
Other DBs
NCBI-GeneID: 101098912
NCBI-ProteinID: XP_003998254
Ensembl: ENSFCAG00000022878
UniProt: M3WTN9
LinkDB
Position
E2:complement(47317851..47326798)
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKEKEKEKSDGKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggctgtgcagaaggtggtagttcaccccttggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaaacgtgtcgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatcgttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccattaatgaacttatgaagagatactgccctaactcagta
ctggtcattattgacgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagttcacgatgatggaactccaacctcaaaaacatttgagcacgtgaccagt
gaaattggagcagaggaagctgaggaagtcggagtggagcacttgttacgagacatcaaa
gacactacagtgggcactctttcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccaccagatcatctaccagctacaggacgtcttcaacctgctgccggatgtc
agcctccaggagtttgtcaaggccttttacctgaagaccaacgaccagatggtagtggtg
tatttggcctcgttgatccgttctgtggttgccctgcacaacctcatcaacaacaaaatt
gccaaccgggatgcagagaagaaagaaggtcaggaaaaagaagaaagcaaaaaggatagg
aaagatgacaaagagaaagaaaaagagaaggaaaagagtgacggaaagaaagaagagaaa
aaggagaaaaaataa

KEGG   Felis catus (domestic cat): 101100851
Entry
101100851         CDS       T02385                                 
Symbol
PSMD12
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 12
  KO
K03035  26S proteasome regulatory subunit N5
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101100851 (PSMD12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101100851 (PSMD12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100851 (PSMD12)
   05012 Parkinson disease
    101100851 (PSMD12)
   05014 Amyotrophic lateral sclerosis
    101100851 (PSMD12)
   05016 Huntington disease
    101100851 (PSMD12)
   05017 Spinocerebellar ataxia
    101100851 (PSMD12)
   05020 Prion disease
    101100851 (PSMD12)
   05022 Pathways of neurodegeneration - multiple diseases
    101100851 (PSMD12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101100851 (PSMD12)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101100851 (PSMD12)
SSDB
Motif
Pfam: PCI RPN5_C SIX1_SD
Other DBs
NCBI-GeneID: 101100851
NCBI-ProteinID: XP_003997122
Ensembl: ENSFCAG00000027374
UniProt: M3X366
LinkDB
Position
E1:49438883..49467284
AA seq 456 aa
MADGGSERADGRIVKMEVDYSATVDQRLPECEKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPI
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGLELRKGSPESPATDVFGSTEEGERRWKDLKNRVVE
HNIRIMAKYYTRITMTRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcggacggcggctcagagcgggctgatgggcgcatcgtcaagatggaggtggactac
agcgccacggtggatcagcgactgccagagtgcgagaagctggccaaggaaggaagactt
caagaagtcattgaaacccttctctctttggagaaacagacccgcaccgcttctgatatg
gtgtctacatcccgtatcctagttgcagtggtgaagatgtgctatgaggctaaagaatgg
gatttacttaatgaaaatattatgcttttgtcaaaaagacggagccaattaaagcaagct
gttgcaaaaatggttcaacagtgctgtacttacgtcgaggaaatcacagaccttccgatc
aagcttcgattaattgatactctgcgaatggttacagaaggcaagatttatgttgaaatt
gagcgtgctcgactgactaaaacgttagcaaccataaaagaacaaaatggtgatgtgaaa
gaggcagcctccattttacaagagttacaggtggaaacctacggatcaatggaaaagaaa
gagcgagtggagtttattttggagcagatgaggctctgtctagctgtgaaggattacatt
cgtacacaaatcatcagcaagaaaataaacaccaaatttttccaggaagaaaatacagag
aaattaaagttgaaatattataacttaatgattcagctggatcaacatgaggggtcctat
ttgtctatttgtaagcactacagagcaatatatgatactccctgtatacaggcagaaagt
gaaaagtggcaacaggctctgaaaagtgttgtcctctatgtgatcttggctccttttgac
aatgaacagtcagatttggttcaccgaataagtggcgacaagaagttagaagaaattcct
aaatacaaggatcttttaaagctttttaccacaatggagctgatgcgctggtccacgctt
gttgaagactatggactggaattaaggaaagggtctcccgagagtccggcaactgatgtg
tttggttctacggaggaaggtgaaagaaggtggaaagacctgaagaacagagtcgttgaa
cataatattagaataatggccaagtattacacgaggataacaatgacgaggatggcccag
cttctcgatctgtctgttgatgagtcagaagcttttctttcgaatctagtagttaacaag
accatctttgctaaagtagacaggttggcaggaattatcaacttccagagacccaaggat
ccaaataatttattaaatgactggtctcagaaactgaactcactgatgtctctcgttaac
aaaactacacacctcatagccaaagaggagatgatacataatctacaatag

KEGG   Felis catus (domestic cat): 101101591
Entry
101101591         CDS       T02385                                 
Symbol
PSMD13
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
fca  Felis catus (domestic cat)
Pathway
fca03050  Proteasome
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05016  Huntington disease
fca05017  Spinocerebellar ataxia
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    101101591 (PSMD13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101101591 (PSMD13)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101591 (PSMD13)
   05012 Parkinson disease
    101101591 (PSMD13)
   05014 Amyotrophic lateral sclerosis
    101101591 (PSMD13)
   05016 Huntington disease
    101101591 (PSMD13)
   05017 Spinocerebellar ataxia
    101101591 (PSMD13)
   05020 Prion disease
    101101591 (PSMD13)
   05022 Pathways of neurodegeneration - multiple diseases
    101101591 (PSMD13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:fca03051]
    101101591 (PSMD13)
Proteasome [BR:fca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     101101591 (PSMD13)
SSDB
Motif
Pfam: PCI Rpn9_C
Other DBs
NCBI-GeneID: 101101591
NCBI-ProteinID: XP_003993868
Ensembl: ENSFCAG00000002669
UniProt: M3VYX6
LinkDB
Position
D1:116952324..116964982
AA seq 376 aa
MKDVPGFLQQSQSSGPGQAAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLY
ENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGA
LKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFL
GCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAF
NSGNVERFQTLKTSWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSA
KITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIAGMKDRLEFWCTDV
RSMEMLVEHQAHDILT
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaaggacgtacctggctttctgcagcagagccagagctccgggcccggccaggccgcc
gtgtggcaccgtctggaggagctctacacgaagaagttgtggcatcaactgacacttcag
gtgcttgattttgtgcaggacccatgctttgcccaaggagatggcctcattaagctttat
gaaaacttcatcagtgaatttgaacacagggtgaatcctttgtccctggtagaaatcatt
cttcatgtagttagacagatgactgatcccaacgtggctcttacttttctggaaaagact
cgtgaaaaggtgaaaagcagtgatgaggcagtgatcctgtgtaaaaccgcaatcggagct
ctgaaattaaacatcggggacctacaggttacaaaggagacaattgaagacgttgaagag
atgctcaacaacctccctggcgtgacatcagttcacagtcgtttctacgatctctctagt
aaatactatcaaacaatcggaaaccacgcatcctactacaaagatgctctgcggtttcta
ggctgtgtcgacatcaaggatcttccagtgtctgagcagcaggagagagctttcacgctg
ggactagcaggacttcttggcgagggagtttttaactttggagaactcctcatgcacccc
gtgctggaatcactgaggaacaccgaccgccagtggctgattgacaccctttatgccttt
aacagtggcaacgtagagagattccagaccctgaagacctcgtggggccagcagcctgac
ttggcagccaatgaagcccagcttctgaggaaaattcagctgttgtgcctcatggagatg
actttcacacgacctgccaatcacagacaactcacttttgaagaaattgccaaaagtgct
aaaatcaccgtgaacgaggtggagttgctggtgatgaaggcgctctcagtggggctggtg
aaaggcagtattgatgaagtggataagcgggttcacatgacctgggtgcagccccgcgtg
ttggatttgcaacagatcgcgggcatgaaggaccgcctggagttctggtgcaccgacgtc
aggagcatggagatgctggtggagcaccaggcccacgacatcctcacctag

DBGET integrated database retrieval system